KEGG   Rattus norvegicus (rat): 306871Help
Entry
306871            CDS       T01003                                 

Gene name
Dsp
Definition
(RefSeq) desmoplakin
  KO
K10381  desmoplakin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    306871 (Dsp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    306871 (Dsp)
   04147 Exosome [BR:rno04147]
    306871 (Dsp)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    306871 (Dsp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   306871 (Dsp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plectin Spectrin_like SH3_10 Spc7 ERM
Motif
Other DBs
NCBI-GeneID: 306871
NCBI-ProteinID: XP_001058477
RGD: 1305794
Ensembl: ENSRNOG00000013928
UniProt: F1LMV6
Position
17p12
AA seq 2877 aa AA seqDB search
MSCNGGSHPRINTLGRMTRAESGPDLRYEMTYSGGGGGGGGGGGGTSRMYYSRRCTVNDQ
NSDGYCQTGTMSRHQNQNTIQELLQNCADCLMRAELIAQPELKFGEGIQLAWNRELDEYF
TQANDQMEIIDGLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISAPRVRRASSKGGYT
CQSGSGWDEFTKRLTGECLGWMRQQRAEMDLMAWGVDSGSVEQHINSHRSIHNAIGDYRW
QLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEE
LLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDT
LQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQH
LLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQ
KIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAI
LALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIEDLELHYQDFIKN
SQGSEMFGDDDKRRMQSQFTDAQKHYQTLVIQLPGHPQHQTVTKTEITHVGTCQDVNHNK
VIETNRENDKQETWLLMELQKIRRQMEHCEARMTLKNLLLTDQGSTHNITVKINELKSVQ
NDSQALAEVLNQLKDMLANFRGSEKYCYLQNEIFGLFQKLENINGVTDGYLNSLCSVRAL
LQAILQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQ
KAQQIHSQSSQQYPLYDLDLGKFTEKVTQLTDRWQKIDKQIDFRLWDLEKQIKQLRNYRD
NYQSFCKWLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHNEISGKRDKSEEVHKIAEL
CANSIKDYELQLASYTSGLETLLNIPIKRTMVQSPSGVILQEAADIHARYIELLTRSGDY
YRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFK
AKLVSLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKTVEDRFD
QQKNDYDQLQKARQCEKESLGWQKLESEKAIKEKEYEIERLRVLLQEEGARKREYENELA
KVRNHYNEEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEI
VRLNDSILQATEQRRRAEENALQQKACGSEIMQKKQHLEVELKQVIQQRSEDNARHKQSL
EEAAKTIQDKNKEIERLKAEYQEEAKRRWEYENELSKVRNSYDEEIISLRNKFETEINIT
KTTIHQLTMQKEEDTSGYRAQIDNLTRENRSLSEEVKRLKNTLAQTTENLRRVEENVQQQ
KASGSEMSQRKQQLEIELRQVSQMRTEESMRYKQSLDDAAKTIQDKNKEIERLKQLVDKE
TNERKCLEDENSKLQRVQYDLQKANNSATEAMSKLKVQEQELTRLRIDYERVSQERTVKD
QDITRIQSSLKDLQLQKQKAEEELSRLKRTASDESSKRKMLEEELEAMRRSLKEQAVKIT
NLTQQLEQASIVKKRSEDDLRQQRDVLDGHVREKQRTQEELRRLSLDVEALRRQLVQEQE
NVKQAHLRNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYDD
LRRGRSEADNDKNSTISELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALE
ASNRIQESKSQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKATLEAETRVKQRL
ECEKQQIQNDLNQWKTQYSRKEETIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERC
RRKLEDSTRETQSQLETERCRLQKEIDKLRQRPYGSHRETQTEYEWTVDSSKLVFDGLRK
KVTAMQLYECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGAIAGASASPKEKYSLVE
AKRKKFITPESTVMLLEAQAATGGIIDPHRNEKLTVDNAIARDLIDFDDRQQIYTAEKAI
TGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQLASGGVVDPVNSVFLPKDVALARGL
IDRDLYRSLNDPRDSQKNFVDPITKKKVSYMQLRERCRIEPHTGLLLLSVQKRSMSFQGI
RQPVTVTELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQKLG
IYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAE
RAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDMAYK
RGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKKQV
QTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDG
STRVVLVDRKTGSQYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNGVGTSSGL
SGSVNDDVFSSSRHESVSKISTISSVRNLTIRSSSLSDPLEESSPIAAIFDTENLEKISI
TEGIERGIVDSITGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQGLIDQDMATRLKPAQK
AFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQFLTGGLVDPEVHGRISTEEAIRK
GFIDGRAAQRLQDISSYAKILTCPKTKLKISYKDAMNRSMVEDITGLRLLEAASVSSKGL
PSPYNMSAPGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGY
NT seq 8634 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaacggcggctcccacccgcggatcaacacgctgggtcgcatgacccgcgcg
gagtccggccccgacctgcgctacgagatgacctacagcggaggcggcggcgggggcggc
ggcggcggcggtggcaccagcaggatgtactactcccggcgctgcactgtcaacgaccag
aactccgacggctactgtcaaaccggcaccatgtccaggcatcagaaccagaacactatc
caagaacttctgcaaaactgcgcagactgtctgatgcgggcagagctgatcgcacagccg
gaactgaagttcggagaaggaatccagctggcgtggaacagagaactggatgagtatttc
actcaagccaatgatcagatggaaatcatagatggcttgatccgggagatgaggcagatg
ggccagccctgtgatgcgtatcagaaaagactgcttcagctccaggaacagatgcgagcc
ctgtacaaggccatcagtgcccctcgagtgcgaagggccagctccaagggagggtacact
tgtcagagtggctccgggtgggatgaattcaccaaacgcctgacgggcgagtgcctgggc
tggatgaggcagcagagggcggaaatggacctgatggcctggggtgtggactctggttca
gtggagcagcacatcaacagccacaggagtatccacaatgccatcggagactaccgctgg
caactggacaagatcaaagcagacctgcgtgagaagtccgcaatctatcaattggaggag
gaatatgaaaacctgctgaaagcctccttcgagaggatggaccacctgcgccagttgcaa
aacatcatccaggccacctcgagagagatcatgtggatcaatgactgtgaggaggaggag
ctgctgtatgactggagcgacaagaacacaaacatcgctcagaagcaggaggccttctct
atccgcatgagtcaactggaagtcaaggaaaaggagctcaacaagcttaaacaagaaagt
gaccaacttgtcctcaatcagcatccagcgtcagacaaaatcgaggcatatatggatact
cttcagacacagtggagttggattctgcaaatcaccaagtgcatcgatgtccacctcaaa
gaaaatgctgcctactttcagttttttgaagaggcccagtcaactgaagcctacctgaag
ggactgcaggactccatcaggaagaaatacccctgtgacaagaacatgcccctccagcac
ctgctggagcagatcaaagagctggagaaagaacgggagaagatcctggaatacaagcgt
caggtgcagaacttggtgaacaagtccaagaagatcgtgcagctgaagcctcggaaccca
gactacagaagcaacaaacccattattctcagggccctctgcgactacaaacaagaccag
aaaatcgtccacaagggggatgaatgcatcctcaaggacaacaatgagcgcagcaagtgg
tacgtgaccggccccggaggcgttgacatgcttgtcccttctgtgggcctgatcatccct
cctccaaacccactggctgtggacctttcttgcaagattgagcagtactatgaagccatc
ttggctctgtggaaccagctctacatcaacatgaagagcctggtgtcttggcattactgt
atgattgacatcgagaagatcagagccatgactattgccaagctgaaaaccatgagacag
gaagattacatgaagaccattgaagacctggagctccattaccaagacttcatcaaaaac
agccaaggctcggagatgttcggagacgatgacaaacggaggatgcagtctcagttcact
gatgcccagaagcattaccagaccctggtcattcagcttcctggccacccccagcaccag
acagtcaccaaaactgaaatcactcacgtgggtacctgccaggatgtcaaccacaataaa
gtaattgagactaacagagagaacgacaaacaggagacgtggctgctgatggagctgcag
aagatccgcaggcagatggagcactgcgaggccagaatgacactcaaaaatctgctgctc
acagaccagggctctacacacaacatcaccgtgaaaatcaacgagctcaagagtgtacag
aacgactcacaagctctggccgaggttctcaatcagcttaaagacatgcttgccaacttc
cgagggtctgaaaagtactgctatttacagaatgagatatttggactatttcagaagctg
gaaaatatcaatggtgtcacagatggctacttaaacagcctgtgctctgtgagagccctt
ctccaggcaattctgcaaacggaagacatgttgaaggtctacgaagcgaggctgacggag
gaggaaactgtctgtctggacctggataaagtggaggcttaccgctgcgggctgaagaaa
ataaaaaatgacttgaacttgaaaaagtcactgttggccaccatgaagacggagctgcag
aaggcacagcagattcactcccagtcttcacagcagtacccgctctatgacctggacctg
ggcaaattcactgagaaagtgacacagctgacggatcgctggcaaaagatagataagcag
atagactttagattgtgggacctggagaaacaaatcaaacaactgaggaattatcgtgac
aactatcagagcttctgcaagtggctgtatgatgccaaacgccgccaggactctttggag
tccatgaagttcggagattccaacacagtcatgcggtttttgaatgagcagaagaacctg
cacaatgaaatatctggcaaacgggataaatcagaagaagtacataaaattgctgagctt
tgcgcaaactcaattaaggattatgaactccagctggcgtcatacacctcagggctggaa
actctactgaacatacctattaagaggaccatggttcagtccccatctggggtaattctg
caagaggctgcggacatccatgcaaggtacatcgagctacttacaaggtctggagactac
tacagattcttaagtgagatgctgaagagcctagaagatctgaagctgaaaaacaccaag
attgaagttttggaagaggagctaagactggcccgggatgccaactcggaaaattgcaat
aagaataagttcctagatcagaacctgcagaaataccaggccgagtgttcccagttcaaa
gcaaagcttgtgagcctggaggagctgaagagacaagctgagctggatgggaagtcagcc
aagcaaaacctagacaagtgctacggtcagatcaaagagctcaatgaaaagatcacccgg
ctgacctatgagatcgaagacgagaagcgcaggagaaagaccgtggaggacaggttcgac
caacagaagaatgactatgatcagctgcagaaggcaaggcagtgtgaaaaggagagcctt
ggctggcagaagctggagtctgagaaagccatcaaggagaaggagtacgagatagagagg
ttgagggttctgctgcaggaagagggcgcccggaagagagaatatgaaaatgagctggca
aaggtaagaaaccactataatgaggagatgagtaatttaaggaacaagtatgaaacagag
attaacatcaccaagaccaccatcaaggagatatccatgcagaaggaagatgattccaag
aatctcagaaaccagcttgacagactgtcccgggagaacagagatcttaaagacgagata
gtcaggctcaatgacagcatcttgcaggccacagagcagcgaaggcgagctgaggaaaac
gcccttcagcagaaagcctgtggctcagaaatcatgcagaagaagcaacacctggaggtt
gaactgaagcaggtcatccagcagcgctcagaggacaatgccaggcacaagcagtccctg
gaggaggctgccaagacaattcaggacaaaaataaagagatcgaaagactcaaagctgag
tatcaggaggaggccaagcgtcgctgggaatacgaaaatgaactgagtaaggtaaggaac
agttacgatgaggagatcattagcttaagaaacaagttcgagactgagatcaacatcacc
aagaccaccatccaccagctgaccatgcaaaaggaagaggataccagcggctaccgagct
cagatagacaacctcacccgggagaacaggagcctgtctgaggaggtaaagaggctaaag
aacactctagcccagaccaccgagaacctcaggagggttgaagagaatgtccagcagcaa
aaggccagtggctcagagatgtctcagaggaaacagcagttggagatcgagctccgacag
gtcagtcagatgcggaccgaagagagcatgaggtacaagcagtccctcgatgatgctgcc
aagacgatccaagataaaaacaaggagattgaaaggctcaaacagctggtagacaaagag
accaatgagaggaaatgcctggaggacgaaaattccaagttgcagagagtgcagtatgac
ctgcagaaagccaacaacagcgccacggaggccatgagcaagctgaaggttcaggaacag
gaactgacacgcctgcggattgactatgagagggtttcccaggagaggaccgtgaaggat
caggacatcacgaggatccaaagctccctgaaggatctgcagctgcagaagcagaaagca
gaagaggagctgagtaggctgaagagaacggcctccgacgagtcctccaagaggaagatg
ctggaggaggagctggaggccatgaggaggtctttgaaagagcaagcggtcaagatcacc
aacctgacccagcagctggagcaggcatccattgttaagaagaggagcgaggatgatctc
aggcagcagagggatgtgctggatggccatgtgagggagaagcagaggacccaggaggag
ctgaggaggctctccttggatgtagaggcccttcggcggcagctcgtgcaggaacaggaa
aatgtcaagcaggctcacttgaggaatgagcatttccagaaggccatagaagacaaaagc
aggagcctcaatgaaagtaaaatagagattgaaaggctacagtctctcacggagaacctg
accaaggagcatttgatgctggaggaggagctgcggaacctgaggctggaatacgacgac
ctacggaggggccgaagcgaagcagataacgataaaaactcaaccatttcggagctaagg
agccagctgcagatcagcaacaatcgaaccctggaactgcaggggctgattaatgattta
cagagagagagggaaaatttgagacaggaaattgagaaattccaaaagcaggctttagag
gcatctaataggattcaggagtcaaagagtcagtgcactcaagtcgttcaggagagagag
agcctgctggtgaagattaaggtcctggagcaagacaaggcaaggctgcagcggctggag
gacgagctgaaccgtgccaaagcaacgctggaggcagaaacccgggtgaaacagcgccta
gagtgtgagaagcagcagatccagaacgacctgaaccagtggaaaactcaatactcccgc
aaggaggagaccattaggaagatagagtcggaaagagagaagagtgagagagagaagaac
agtcttaggagtgagattgagagactccaggcagagatcaagaggattgaagagaggtgc
aggcggaagctagaggattctaccagggagactcagtcccagctggaaacggaacgctgc
aggcttcagaaggagattgacaaactcaggcagcgcccctatgggtcccatcgggagacc
cagacagagtacgagtggaccgttgattcctccaagctggtatttgacggactgaggaag
aaggtgacagcaatgcagctctatgagtgccagttgattgacaagacaacactggacaag
ctattgaaggggaagaagtcagtggaggaggtggcttcagagatccagcctttcctgcgg
ggtgcgggggccatcgctggtgcttctgcttctcccaaggaaaaatactctttggtggag
gccaagagaaagaaattcatcaccccagaatccacagtcatgcttctggaggcccaggcg
gccactggtggtatcatcgatccccatcggaatgagaagctcacggtggacaatgccata
gctcgggacctcattgactttgatgaccgccaacagatctacacagccgagaaagccatc
actggttttgatgacccgttttcaggcaagaccgtatctgtttcagaagccatcaagaag
aatttgattgacagagaaaccggaatgcgcctgctggaagcccagcttgcttcagggggt
gtagttgatccagtcaacagtgtctttttgccaaaagatgtagccttggcccgtgggctg
attgatagggatttgtatcgctccttgaatgacccccgagatagccagaagaacttcgtg
gatccaatcaccaagaagaaggtcagctacatgcagctgagagaacggtgcagaatcgaa
ccccacacgggtctgctcctgctgtcagtacagaagagaagcatgtccttccaaggaatc
agacagccagtgaccgtcaccgaactggttgattctggcatattgagaccatccaccgta
aatgaactggaatctggtcagatttcttatgacgaggttggcgagagaattaaggacttc
ctccaggggtcaagctgcatagcaggtatttataatgagaccacgaaacagaagcttggc
atctacgaggctatgaaaattggcttagttcgacctggtaccgctctggagttgctggaa
gcccaagcagctactggttttatagtagatcctgtcagcaatttaaggttacctgtggag
gaagcctacaaaagaggtctggtgggcattgagttcaaagagaagcttctctctgcagaa
cgagctgtcactggctataacgatcctgaaaccggaaacatcatctctttgttccaagcg
atgaacaaggaactcatcgaaaagggccacggaattcgcttactggaggctcagatcgca
accggcggtatcattgatccaaaggagagtcatcggttaccggttgacatggcttataag
aggggctattttaacgaggagcttagcgaaatcctctcagacccaagtgatgataccaaa
ggctttttcgatcccaacactgaagaaaacctcacctatttgcaactgaaagaaaggtgc
atcaaagatgaggagacggggctctgcctgctgcctctgaaagaaaagaagaaacaggtg
cagacttcacagaagaacaccctcagaaagcggcgggtggtaatagttgacccagaaacc
aacaaagagatgtctgttcaggaggcgtacaagaaaggccttattgattatgaaaccttc
aaagagctgtgtgagcaggagtgtgaatgggaagaaataaccatcacgggttcggatggc
tccaccagggtagtcctagtagacaggaagacgggcagtcagtatgacattcaagatgct
attgacaaaggcctcgtcgacaggaagttcttcgatcaataccgatccggcagcctcagc
ctcacgcagtttgcggacatgatctccttgaagaatggcgttggcaccagcagcggcttg
agcgggagtgtcaacgatgatgtgtttagcagctctcgacacgaatccgtgagtaagatt
tccaccatatccagcgtcagaaatttaaccatccgaagcagctctctgtctgaccccctg
gaggagtcaagccccattgcggccatctttgacacagaaaacctggagaaaatctccatt
acagaaggtatagagcggggcattgtggatagcatcactggtcagaggcttctggaagct
caggcctgcacgggtggcatcatccaccctaccaccggtcagaagctgtcccttcaagac
gcagtctcccagggtctcattgaccaagacatggccaccaggctgaagcccgcccagaag
gccttcattggctttgaaggtgtcaaaggaaagaagaagatgtcagcagcagaggcagtg
aaagaaaaatggctgccctacgaggcaggccagcgcttcctggagttccagttcctcacc
ggaggccttgttgacccggaagtacatgggaggatcagcaccgaagaagccatccgcaaa
ggtttcatcgatggccgtgcagctcagaggttgcaggacatcagcagctatgccaaaatc
ctcacctgccccaaaaccaaattaaaaatctcctacaaggatgccatgaatcgctccatg
gtggaagacatcactgggctgcgccttctggaagccgcctccgtgtcctcgaagggtttg
cctagcccttataacatgtcggccccaggctcccgctctggctcgaggtccggatctcgc
tcaggctcccgctctggttcccgtagtgggtctcgaagaggaagcttcgatgcgaccggg
aattcctcctactcctattcctattcatttagcagtagctccattgggtactag

DBGET integrated database retrieval system