KEGG   Rattus norvegicus (rat): 306886Help
Entry
306886            CDS       T01003                                 

Gene name
Ripk1
Definition
(RefSeq) receptor interacting serine/threonine kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04210  Apoptosis
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04668  TNF signaling pathway
rno05160  Hepatitis C
rno05163  Human cytomegalovirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    306886 (Ripk1)
   04668 TNF signaling pathway
    306886 (Ripk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    306886 (Ripk1)
   04217 Necroptosis
    306886 (Ripk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    306886 (Ripk1)
   04621 NOD-like receptor signaling pathway
    306886 (Ripk1)
   04622 RIG-I-like receptor signaling pathway
    306886 (Ripk1)
   04623 Cytosolic DNA-sensing pathway
    306886 (Ripk1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    306886 (Ripk1)
   05160 Hepatitis C
    306886 (Ripk1)
   05163 Human cytomegalovirus infection
    306886 (Ripk1)
   05169 Epstein-Barr virus infection
    306886 (Ripk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    306886 (Ripk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     306886 (Ripk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   306886 (Ripk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Death RHIM Kdo Kinase-like RIO1 Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 306886
NCBI-ProteinID: NP_001100820
RGD: 1310158
Ensembl: ENSRNOG00000017787
UniProt: D3ZYL0
Position
17p12
AA seq 658 aa AA seqDB search
MQPDMSLDNIKMASDDLLERKDLDSGGFGKVSLCFHRTHGFVILKKVYTGPNRAEYNEAL
LEEGKMMHRLRHDRVVKLLGIIIEEGNYSLVMEYMEQGNLMHVLKTKESVPLSVKGRIIV
EIIEGMHYLHDEGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEEHNKQREAS
SVTKKNGGTLYYMAPEHLTDINTKPTEKSDVYSFAIVLWAIFANKEPYENVICTEQFLVC
INSGNRPNVEDILEFCPREIISLMERCWQTNPEDRPTFFGIEKEFKPFYLSQFEEYVEED
VASLKKEYPSQSPVLKRMFSLQHDCVPLPPSRSNSEQPGSLHSSQGLPMGPVEESWFSSS
PEYPQEENERSVQAKLQEEASYHAFGIFAEKQTKSQPRLNEAYNREEERKRRVSHDPFAQ
QRVHENVKSAGAKGLPYPSTTSHGNAAHQLSGPASQIKVPLWNNGVYNHHGFGATGTGVW
YGPSVSQSYNAYKTPVPETNLPGSIPTMPYISLAPPDDSIRCTIYNSSRVQIGNYNYMDL
GPSSQPPTNTCKVESTSRHQAVFANTTSLTDKHLNPIRENMGKQWKNCARKLGFTESQID
EIDHDYERDGLKEKVYQMLQKWLMREGTKGATVGKLAQALHQCCRTDLLNQLIQASQS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagacatgtccttggacaatattaaaatggcatccgatgacctgctggagagg
aaagacctggacagcggaggcttcgggaaggtgtccttgtgtttccacagaacccatgga
tttgtcatcctgaaaaaagtatacacgggacccaaccgcgctgagtacaatgaggctctc
ttggaagaggggaagatgatgcacagactgagacacgatcgagtggtgaagctactgggc
atcatcatagaggaggggaattactcgctggtgatggagtacatggagcagggcaacctg
atgcacgtgctgaagaccaaggaaagtgtcccactttctgtgaaaggaaggataatcgtg
gagatcatagaaggcatgcactacttacatgacgaaggtgtaatacacaaggacctgaag
cctgaaaatatcctcgttgaccgtgactttcacattaagatagccgatcttggtgtggct
tcctttaagacatggagcaaactgactaaggaggaacacaacaagcagagggaggccagc
agcgtcaccaagaagaacggaggcaccctctactacatggcaccggaacacctgactgac
atcaacacaaagcccacagagaagtcagatgtgtacagcttcgccattgtgctttgggca
atatttgctaataaggagccctatgagaatgtcatctgtactgagcagttcttggtctgc
ataaactctgggaacaggccaaatgtggaggacatccttgagttctgtccaagggagatc
atcagcctcatggagcggtgttggcagaccaacccagaagacaggccaacattttttggc
attgaaaaagaatttaagcctttttacttaagtcaatttgaagaatatgtagaagaggat
gtggcaagtttaaagaaagaatatccaagtcaaagcccagttttgaagagaatgttttct
ctgcagcatgactgtgtgcccttacctccaagcaggtcaaattcagaacaacccggttcg
ctgcacagttcccagggactcccaatgggacctgtggaggagtcctggttttcttcctcc
ccagagtacccacaggaagagaatgagcgcagtgtgcaggctaaactgcaagaggaagcc
agctatcatgcttttggaatatttgcggaaaaacagacaaaatcacagccaaggctgaat
gaggcttacaacagagaggaggaaaggaagcgaagggtctcccatgacccctttgcacag
cagagagttcatgagaatgttaagagtgcaggagcaaaaggtcttccttatcccagcaca
accagtcatggaaatgcagcgcaccagctgtcagggccagccagccaaatcaaagtgcca
ctttggaacaacggagtatataatcatcatgggtttggagctacaggtacaggagtttgg
tatgggccaagtgtaagccaatcatataatgcttataaaactccagtgcctgagaccaac
ctaccaggaagcatacccaccatgccatacatctccttggcaccaccagatgactccata
agatgtactatatacaatagttctcgtgttcagattggaaactacaactatatggatctt
ggaccgagttcacaaccaccaaccaacacttgcaaagtagagtcaacttccaggcatcaa
gccgtcttcgctaacaccactagcctgactgataaacacctgaaccccatcagggaaaac
atgggaaagcagtggaaaaactgtgcccgaaagctgggcttcactgagtctcagatcgac
gaaatcgaccatgactatgaaagagatggactgaaagagaaagtttaccaaatgcttcag
aagtggctgatgcgggaaggcaccaagggagccacggtgggaaagctggcccaggctctt
caccagtgttgcaggacagacctgctgaaccagctgattcaggccagccagagttag

DBGET integrated database retrieval system