KEGG   Rattus norvegicus (rat): 306960Help
Entry
306960            CDS       T01003                                 

Gene name
Abt1
Definition
(RefSeq) activator of basal transcription 1
  KO
K14785  ESF2/ABP1 family protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    306960 (Abt1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    306960 (Abt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 306960
NCBI-ProteinID: NP_001020845
RGD: 1310785
Ensembl: ENSRNOG00000017585
UniProt: Q4KLM5
Position
17p11
AA seq 268 aa AA seqDB search
MVKVGKLVEEQKAAMEEEKEVNAEAAEELEEAEEASCNGSKKKVVPGIVYLGHVPPRFRP
LHVRNLLSVYGEVGRVFFQAEDPFVRRKKKAAAAAGGKKGAKYSKDYTEGWVEFRDKRIA
KRVAASLHNTPMGARKRSPFRYDLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQA
KRETDFYLRNVEQGQRFLAADGDATRPNSSWTFTQRPTEQELRAQKGARPGGRERARLAT
VQDQARSNRGLLARIFGASLLAESRKEP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagtaggaaagctggtggaggagcaaaaggcggcgatggaggaagagaaagag
gtgaatgcagaggcggcggaggagctggaggaggccgaggaagcgtcctgcaacggcagc
aagaagaaggtagttccgggtattgtgtacttgggccacgtcccgccgcgattccggccc
ctgcacgttcgcaacctgctcagcgtctacggtgaggtgggacgcgttttcttccaggcc
gaggacccctttgtgagacgaaaaaagaaggcagccgcggctgcaggaggaaagaaggga
gctaaatacagcaaggactataccgaaggctgggtggagttccgagacaaacgcatagcc
aagcgagtggcagctagtctacataacacacccatgggtgcccgcaagcgcagtcccttc
cgttatgacctgtggaacctcaagtatttgcatcgttttacttggtcccacctcagtgaa
caccttgcctttgagcgccaggtacgaaggcaacgcctgagagcagaggttgcccaagcg
aaacgagagactgacttctatcttcgaaacgtagaacagggacaacgctttcttgcagct
gatggggatgctactcgaccaaatagctcctggacatttactcaacgtcccactgagcag
gagctgagggcccagaaaggagcacggccaggagggcgggaacgagctcggctggccaca
gtccaggaccaggcccgatccaacagagggctacttgccaggatctttggggcctctcta
cttgcagagagcaggaaagaaccgtag

DBGET integrated database retrieval system