KEGG   Rattus norvegicus (rat): 306969
Entry
306969            CDS       T01003                                 

Gene name
Hist1h2bf, Hist1h2bp
Definition
(RefSeq) histone cluster 1, H2bf
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    306969 (Hist1h2bf)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    306969 (Hist1h2bf)
  09165 Substance dependence
   05034 Alcoholism
    306969 (Hist1h2bf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306969 (Hist1h2bf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    306969 (Hist1h2bf)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    306969 (Hist1h2bf)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   306969 (Hist1h2bf)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 306969
NCBI-ProteinID: XP_001061682
RGD: 1308088
Ensembl: ENSRNOG00000053845
UniProt: M0R4L7
Position
17p11
AA seq 126 aa
MPETAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgaaactgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtaacc
aaggcgcagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgcttaagcaagtgcatccggacacgggcatctcttccaaggccatg
ggcataatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggctcattacaacaagcgctcgaccatcacgtcccgggagatccagacggcggtgcgc
ctgctgcttcccggggagctggccaagcacgctgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system