KEGG   Rattus norvegicus (rat): 306977
Entry
306977            CDS       T01003                                 

Gene name
Zkscan3, Zfp307
Definition
(RefSeq) zinc finger with KRAB and SCAN domains 3
  KO
K09229  KRAB and SCAN domains-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    306977 (Zkscan3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    306977 (Zkscan3)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 SCAN zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-met KRAB Zn-ribbon_8 zf_UBZ zinc_ribbon_15 HypA zf-C2H2_11 zf-C2H2_3rep C1_4
Other DBs
NCBI-GeneID: 306977
NCBI-ProteinID: NP_001012053
RGD: 1305753
Ensembl: ENSRNOG00000055000
UniProt: Q5FVP7 F7DP88
Position
17p11
AA seq 553 aa
MARESRESTTLDSHSAEDQMELLVIKVEQEEVSPLAEETSWLGSPGPDRSRQRFRAFRYP
DAAGPRQALSRLRELCRQWLRPDMHSKEQILELLVLEQFLTILPGELQAWVREQHPDSGE
EVVALLEYLDRQLDETPPQVPDDDDGQELLCSKAVLLTSAQGSESSQMESMEPLLKQESL
GSLPSEVRVTQAGHCGEDGVTATRLTSELQGLLKMEDVAPGLSPRWTEQDSSQMNLYKDE
MQENSGSLVSLDENMQTKVRDLPPAEENTEQKPEQTVCFLGEDTVQIPTGTEASEQEGKL
QTTQKNATGNRRFYCRECGKSFAQSSGLSKHKRIHTGLKPYECEECGKAFIGSSALIIHQ
RVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFTQSCSLLEHHRIHT
GEKPYQCNMCPKAFRRSSHLLRHQRTHTGDKDFFVPEPYWESQSRVESHWENIETPVSYQ
CNDCERSFSRITSLIEHQKVHTGEKPFECQTCGKGFTRPSYLIQHQRRHTGKKTSVTVTP
AVHSEVGVQLSLN
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggctagagaatcaagggaaagcacaaccctggactcacactctgcagaggaccagatg
gagctactggtcataaaggtggaacaagaagaggtctccccattggcagaggagaccagt
tggctgggcagtcctgggcctgaccgctcccgccagcgcttccgtgctttccgctaccca
gacgcagcagggccccggcaggcgctgagccggctccgcgagctatgcagacagtggctg
cggccagacatgcacagcaaggagcagatcctggagctgctggtgctggagcagttcctg
accatcctgccaggggagctgcaggcctgggtgcgcgagcagcaccccgacagcggagag
gaggtggtggcactgctggagtacttggacaggcagctggatgagacccctccacaggtt
ccagatgatgacgatgggcaggaactcctttgttccaaggcagtactgttgacatcagct
caaggctcagaaagtagccagatggagtccatggagcctttgcttaaacaggaatctttg
ggatccctgccctcagaagttagagtcacccaggcagggcattgtggagaagatggagtg
acagctaccaggctcacatcagagctgcaggggctgctgaaaatggaagatgtagcccca
ggcctttccccgagatggacagagcaggattcatctcagatgaacctctacaaagatgaa
atgcaggagaactctggcagcctggtttccctggatgagaacatgcaaactaaggttagg
gacttgcctccagctgaagaaaacacagaacaaaagcctgagcagacagtgtgcttcctg
ggtgaagacactgtccagattcctacaggtacagaagccagtgagcaggaaggcaagtta
cagacaacacagaagaatgccacgggaaacaggcggttctactgccgtgaatgtgggaag
agctttgctcagagttcaggcctaagtaaacacaaaagaatccacactggattgaaaccc
tatgaatgtgaggagtgtggcaaagccttcattgggagctcagctctcattattcatcag
agagttcacactggtgagaagccatatgagtgtgaagaatgtggtaaggccttcagtcac
agctcagatctcatcaagcaccagagaacccacactggagaaaagccctacgagtgtgat
gactgtgggaaaaccttcactcagagctgcagcctccttgaacatcacagaattcacact
ggggagaagccataccagtgcaacatgtgtcccaaagcctttaggcgtagctcacatctc
ctgagacatcagaggacccacactggggataaagatttttttgttccagaaccttactgg
gaaagtcagagtagggtggaaagccattgggaaaatattgagactcctgtgtcttatcaa
tgcaatgattgtgagagaagttttagtaggattacaagccttattgaacaccaaaaagta
cacactggtgagaagccctttgaatgccagacctgtggaaaaggctttacccgaccttca
taccttattcaacatcagagaagacacacggggaagaaaacttctgtcacagtgacccct
gctgtacattccgaagttggtgttcaactgtcattgaactga

DBGET integrated database retrieval system