KEGG   Rattus norvegicus (rat): 306994Help
Entry
306994            CDS       T01003                                 

Gene name
Yae1d1, RGD1306613
Definition
(RefSeq) Yae1 domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Yae1_N
Motif
Other DBs
NCBI-GeneID: 306994
NCBI-ProteinID: NP_001100826
RGD: 1306613
Ensembl: ENSRNOG00000013438
UniProt: D4AEK7
Position
17q11
AA seq 220 aa AA seqDB search
MSWFRATPEIPSPGDQDVFDEEADESLLVQREWQDHMRKRVQEGYRDGIDAGKAVTLQQG
FNQGYKEGADVILNYGLLRGTLSALLSWCHLHGNSSTLIGKINNLLDAVGQCEECVIKHL
KSVTSPPHITDLLDSIEDLDLCHVVPPEKAVEARGDTSADISTDADRSPNGMDCSHPECC
RTQEHAHLEKPSLTWILEQTSNLVKQLGISVDILQHLRQL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtttcgagcgactcccgagatccccagccctggagaccaggacgtgtttgat
gaggaagcagacgaatctctgttagtgcagcgggaatggcaggatcacatgaggaaacga
gtccaagaaggttacagagatgggatagatgctggcaaagcagtaacccttcaacagggc
ttcaatcaaggctataaagagggtgccgatgtcattttaaactacggactactcagggga
acattgagcgctttgctttcctggtgtcaccttcatggtaatagttcaacgctgattggc
aagataaataaccttctggatgcagttggccagtgtgaagagtgtgtgatcaaacatctg
aaatcagttacgtcaccgccacacattacagatttattggactccattgaggatctggac
ctttgtcatgtagtcccgcctgagaaagctgttgaagcaagaggtgacactagtgctgac
attagcacagatgctgacaggagtccgaatgggatggattgttcacatccagaatgttgc
agaacacaagagcatgcgcatttggaaaagccaagcctcacttggattctggaacagaca
tccaacttggtgaaacagctgggaatatcagtagacatattacagcacctgagacaactg
taa

DBGET integrated database retrieval system