KEGG   Rattus norvegicus (rat): 307133
Entry
307133            CDS       T01003                                 

Gene name
Hspa14
Definition
(RefSeq) heat shock protein family A, member 14
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FtsA
Other DBs
NCBI-GeneID: 307133
NCBI-ProteinID: NP_001004257
RGD: 1303296
Ensembl: ENSRNOG00000015212
UniProt: Q6AYB4
Position
17q12.3
AA seq 509 aa
MAAIGVHLGCTSACVAVYKDGRADVVANDAGDRVTPAVVAYSEREQVVGLAAKQSRIRNI
SSTVVKVKQILGRSTADPQAQKYISESKCLVIEKNGKLQYEIDTGEETKLVSPEDVARLI
FSKMKETAHSVLGSDANDVVVTVPFDFGEKQKSALGEAAGAAGFNVLRLIHEPSAALLAY
GIGQDCPTGKSNVLVFKLGGTSLSLSIMEVNSGMYRVLSTNTSDNIGGVHFTDSLAQYLA
SEFQRLFKHDVRGSARAMMKLMNSAEVAKHSLSTLGSANCFVDSLYEGQDFDCNVSRARF
ELLCSPLFNKCIEAVRALLQQSGFTADDINKVVLCGGSSRIPRLQQLIKDLFPAGDLLNS
IPPDEVIPIGAAIEAGILVGKESTSGDDSVLIECSARDILVKGVDESGANRFTVLFPSGT
PLPARRQHTLQAPGSISSVCLELYESEGKNSVKEETKFAQVVLQDLDKKENGLRDILAVL
TMKRDGSLQVTCTDQETGKCEAITVEVAS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggcggcgatcggcgtgcacctgggctgcacatcagcctgtgtggctgtctacaaggat
ggccgggccgatgtggttgcaaatgatgcgggggacagagtcacgccagccgtcgttgct
tactcggaacgtgaacaggtggttggactggcggcaaaacaaagtaggataaggaatatc
tcaagcacggtagtgaaagtaaaacagatccttggcagaagcactgctgatccacaggct
cagaaatatatctcggaaagtaaatgcttagtcattgagaaaaatgggaagttgcagtat
gaaatagatacaggagaagaaacaaaactcgttagtccagaagatgttgccagactgata
ttcagtaaaatgaaagaaacagcacattctgtcctgggctcagatgcaaacgatgtcgtt
gttaccgtcccatttgacttcggagaaaagcagaagtctgctctgggagaggcagctgga
gccgccgggtttaatgtgttgcgactaatacatgagccgtctgcagctctcctggcctat
ggaattggacaagactgccctaccgggaagagcaatgttttggtgtttaagctgggagga
acatccttgtcgctcagtatcatggaagtgaacagcgggatgtatcgggttctttccaca
aacaccagtgacaacatcgggggtgtgcatttcacagacagcttagctcagtacctggct
tcggagttccagaggctgttcaagcacgatgtgagaggaagtgcccgggccatgatgaag
ctgatgaacagcgctgaggtggccaagcactccctgtccaccctgggaagtgccaattgc
ttcgtggactccttgtatgaaggtcaagacttcgactgcaatgtgtccagagcaagattt
gagcttctttgttctccgctttttaacaaatgtatagaagcagtccgggcgctcctacag
cagagtggatttacagcagatgacattaacaaggttgtgctgtgtggtggatcgtcaagg
atcccaaggctgcagcagctgattaaagatctcttcccagctggggaccttctcaactcc
atccctccagatgaggtcatccctatcggtgcagccatcgaggccgggattcttgttggg
aaggagagcacctcaggggatgactctgtcctgatcgagtgttcagcccgggatatttta
gttaagggagtcgatgaatcaggtgccaacagattcacagtgctgttcccctctgggact
cctctgccagcgcgaagacagcacacgctacaagcccctggcagtatatcttctgtttgc
cttgaactctatgagtctgagggcaagaactctgttaaagaggagaccaagtttgcacag
gttgtgctccaggacttagataaaaaagaaaatggattacgtgatatattagctgtcctt
actatgaaaagggatggatctttacaggtgacgtgcacagaccaagagaccgggaagtgt
gaggccatcactgttgaagttgcatcctaa

DBGET integrated database retrieval system