KEGG   Rattus norvegicus (rat): 307151Help
Entry
307151            CDS       T01003                                 

Gene name
Bmi1, Pcgf4
Definition
(RefSeq) BMI1 proto-oncogene, polycomb ring finger
  KO
K11459  polycomb group RING finger protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05202  Transcriptional misregulation in cancer
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    307151 (Bmi1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    307151 (Bmi1)
   05206 MicroRNAs in cancer
    307151 (Bmi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    307151 (Bmi1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     307151 (Bmi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 Prok-RING_4 zf-RING_UBOX zf-C3HC4_4 zf-Nse zf-RING_10
Motif
Other DBs
NCBI-GeneID: 307151
NCBI-ProteinID: NP_001100838
RGD: 1307403
Ensembl: ENSRNOG00000016585
UniProt: B4F7B6
Position
17q12.3
AA seq 324 aa AA seqDB search
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DRRVIADDEIISLSIEFFHPSRSDRKVTKEKPKEEVNDKRYLRCPAALTVMHLRKFLRSK
MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKMSQQRDG
LTAAGELESDSGSDKANSPAGGAPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSG
NHQSSFASRPRKSSVNGSSATSSG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgaacaaccagaatcaagatcactgagctaaatccccacctaatgtgtgtcctg
tgtggagggtacttcattgatgccactaccataatagaatgtctacattccttctgtaaa
acatgtattgtgcgttacttggagaccagcaagtattgtcctatttgtgatgtccaagtt
cacaaaactcgaccactactgaatataaggtcagacaaaactcttcaagatattgtatac
aaattagttccagggcttttcaaaaatgagatgaagaggagaagagacttctatgcagct
cacccttcagcagatgctgccaatggctccaatgaagacagaggagaagttgcagatgag
gaccggcgggtcatagctgacgatgagattataagcttgtctatcgagttcttccaccca
agcaggtcggatcggaaagtaactaaagagaagccaaaggaggaggtgaatgataaaagg
tacttgcgatgcccagcagcactgacggtgatgcacttgagaaagttcctcaggagtaaa
atggacatacctaatactttccagattgacgttatgtatgaagaggagcctttaaaggac
tactacacgctcatggacattgcctacatttacacctggagacggaatggcccactgcct
ttgaaataccgagttcggccaacttgcaaaagaatgaagatgagtcagcagagagatgga
ctgaccgcggctggagagctggagagtgactctgggagcgacaaggccaacagcccagcg
ggaggtgctccctccacctcttcctgcttgcccagccccagcactccagtgcagtctcct
cacccacagttccctcacatttccagtaccatgaatggaaccagcaacagccccagcggt
aatcaccaatcttcctttgccagtagacctcggaaatcatcagtaaatgggtcatcagca
acttcgtctggttaa

DBGET integrated database retrieval system