KEGG   Rattus norvegicus (rat): 307171
Entry
307171            CDS       T01003                                 

Gene name
Apbb1ip
Definition
(RefSeq) amyloid beta A4 precursor protein-binding family B member 1-interacting protein
  KO
K17704  amyloid beta A4 precursor protein-binding family B member 1-interacting protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    307171 (Apbb1ip)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    307171 (Apbb1ip)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    307171 (Apbb1ip)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   307171 (Apbb1ip)
SSDB
Motif
Pfam: RA PH PGA_cap PH_11
Other DBs
NCBI-GeneID: 307171
NCBI-ProteinID: NP_001094047
RGD: 1304795
Ensembl: ENSRNOG00000017803
UniProt: D3ZDZ1
Position
17
AA seq 664 aa
MGESNEDIDQMFSTLLGEMDLLTQSLGVDTLPPAEPKPPREEFNFSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQNQGHSALLEASDGQGTAPRGYGANAAAFD
VSDYEEALPPPPADPMLDLLPPPPPPPPKPLSKEEEEALAKADKIKLALEKLKEAKVKKL
VVKVHMGDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERIFEDHE
NVVEVLSDWTRDTENRVLFLEKEEKYAVFKNPQNFYLDNKGKKEKESNEKMNAKNKEYLL
EESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQF
ENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKY
GKTLYDNYQRAVARAGLASRWTNLGTATTPAQPAAGLKTGTSQPNGPMPQAAPSPGPPLR
ETLTQTETTKDEKQGLANHSPGASRENHRPKSSLLPPPPPVRRSSDTCGSPALPPKAKGP
GSCTFTAQPENFLPPPPPPPPQEDDNSMLLPPPPPLAYLDEPPDFVPPPPPPATVEDSAL
PPPPPPPPCLSQEMTKSSPLPAKKLPVPPKRQENQGLPGAPRNTEQDFMSDLMKALQKKR
GNVP
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgggtgaatcaaatgaagacatagaccagatgttcagcactctgctgggggagatggat
ctcttgacccagagtttaggagtggacactcttcctcctgcagaacccaagccaccccga
gaagagtttaacttcagtgtggggtttaaggatttaaatgagtccttaaatgcactggaa
gaccaagatttagatgccctcatggcagatctggtagcagatataagtgaagccgaacag
agaaccatccaggctcagaaagagtcctctcagaatcaaggtcactcagcacttctggag
gcctcagatggccagggtacagccccaagaggttatggagcaaatgctgctgcttttgat
gttagcgactacgaggaagctttaccacctccaccagcagatcccatgctagaccttcta
ccccctccacctcctcctcctcctaaacctctctctaaagaggaagaagaagccctagca
aaggctgataagattaagttggcactggaaaagttgaaggaagccaaggttaagaagctt
gtagttaaggtgcacatgggtgacaacagtaccaagtcactgatggtggatgagcgacag
ttggctcgggatgttctcgacaatctttttgaaaaaacccactgcgactgcaatgtggac
tggtgcctttatgaaatatatcccgaattgcaaatcgagagaattttcgaagaccatgaa
aatgttgttgaagtcttatcagactggacaagagacacagagaacagagtactgtttttg
gagaaagaggaaaaatatgctgtgtttaaaaaccctcagaatttctacttggataataag
gggaaaaaagaaaaggaaagcaatgagaaaatgaatgctaaaaacaaagaatacttactt
gaggaaagtttctgtggcacatccatcatagtaccggaacttgaaggagctctttatttg
aaagaagacgggaagaagtcctggaaacgacgctactttcttctgagagcttctggaatc
tattatgtacccaaaggaaagacaaagacatcccgagacctggcgtgtttcatacagttc
gaaaatgttaacatttactatgggattcagtgcaaaatgaaatacaaagcacccactgac
cactgctttgttttaaagcatcctcaaattcagaaggaatctcagtacatcaagtacctt
tgctgtgatgacgcaagaactctcagccagtgggttatgggaataaggatcgccaagtac
gggaaaactctctatgataactatcagcgggctgtggctagagctggactcgcctctcgg
tggacgaacctggggactgccactacaccagctcagcctgctgcaggacttaaaacaggc
accagccagcccaatggtccaatgccccaggccgcgccttcccctggtcctcctctccga
gagaccctgacacaaactgaaacaactaaggatgaaaagcaaggcttggctaaccactcc
ccaggagcaagcagggagaaccaccgccctaagagcagcctgcttccaccaccccctcca
gtaagacgatcttcggacacctgtggcagccctgccttgccacccaaagccaagggccct
ggcagctgcaccttcaccgcccagcccgagaacttcctgccaccaccaccgcccccaccg
ccccaggaggacgacaacagcatgctactcccaccacccccacccctggcctacctcgat
gagccaccggatttcgtgccaccgcccccaccacctgcaactgttgaagactctgcattg
ccacccccgccgccacccccaccctgtctctcccaggagatgaccaagtcatctccattg
cccgccaaaaagctcccagtgccccccaagaggcaagagaaccaaggactccctggtgcc
ccaaggaacacggagcaagattttatgtcagacctcatgaaagcattgcaaaagaaaaga
ggcaatgtaccctag

DBGET integrated database retrieval system