KEGG   Rattus norvegicus (rat): 307206Help
Entry
307206            CDS       T01003                                 

Gene name
Neto1, RGD1566269
Definition
(RefSeq) neuropilin and tolloid like 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: CUB Ldl_recept_a Waikav_capsid_1
Motif
Other DBs
NCBI-GeneID: 307206
NCBI-ProteinID: NP_001100841
RGD: 1566269
Ensembl: ENSRNOG00000014006
UniProt: D4AAD6
Position
18q12.3
AA seq 533 aa AA seqDB search
MIYGRSLFHIIASLIILHSSGATKKGTEKQITPETQKSVQCGTWTKHAEGGVFTSPNYPG
KYPPDRECVYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPACEFEMGGPE
GIVESIQILKEGKASASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIVS
VIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVAEDFENYHKL
RRSSSKCIHDHHCGSQLSSAKGSRSNLSTRDASILAEIPTQPVKPLIPPVNRRNILVMKH
NYSQDAADACDIDEIEEVPTTSHRLSRHEKSVQRFCLIGSLSKHESEYNTTRV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgatctatggacgcagtttgtttcacattatagcaagtttaatcatcctccattcttct
ggagcaaccaagaaaggaacagaaaaacaaatcaccccagaaacacagaagtcagtgcag
tgtggaacgtggacaaaacatgcagaggggggtgtctttacctctcccaattatcctggc
aaatatcccccagaccgagaatgtgtctacatcatagaagctgccccaaggcaatgcatt
gaactttactttgatgaaaagtactcaatcgaaccatcttgggagtgcaaatttgatcat
attgaagttcgagatggaccctttggcttctctccaataattggaaggttctgtggacaa
cagaatccacctgttataaaatctagtggaagatttctgtggattaaattctttgctgat
ggggagctggagtctatgggattttcagctcgatataatttcacacctgatcccgacttt
aaggaccttggagttttgaaaccgttgccagcgtgtgagtttgagatgggcggcccggaa
ggaattgtggagtccatacagattctgaaggaaggcaaagcttctgccagtgaagccgtg
gattgcaaatggtacatccgagccccaccacgatccaagatttatttacgtttcttggac
tatgagatgcagaattcaaatgagtgcaaaagaaactttgtggcggtctatgacggaagc
agctctgtggaggacttgaaggccaagttctgcagcacggtggctaatgacgtcatgctg
cgcacaggccttggggtgatccgcatgtgggcagacgagggcagccgcaacagcaggttt
cagatgctcttcacatcttttcaagaacctccctgtgaaggcaacacattcttctgccac
agtaacatgtgtattaacaacacactagtctgcaatgggctccagaactgtgtatatccc
tgggatgaaaatcactgtaaagaaaagaggaaaaccagcctgctggatcagctgaccaac
accagtgggacggtcattggcgtgacttcctgcattgtgatcatccttattatcgtttct
gtcattgtacagatcaaacagcctcgtaaaaaatacgtccaaaggaagtcagactttgac
cagaccgttttccaggaggtgtttgagcctcctcactatgagttatgcacgctcagagga
accggagcaacagctgactttgcagatgtggcagaagactttgaaaattaccataaactg
cgaagatcatcttccaaatgcatccatgaccatcactgtggatcacaactgtccagcgcg
aaaggcagtcgcagtaacctcagcacaagggacgcttctatcttggcagagatacccacg
cagccagtcaagcccctcatcccacccgtgaacagaagaaacatcctggtcatgaaacac
aactactcacaagatgccgcagatgcctgtgacattgacgagattgaggaggttcccacc
acgagccacaggctatccagacacgaaaaatccgtccagcggttctgcctcattgggtct
ctaagcaaacatgaatctgaatacaacacaactagggtctaa

DBGET integrated database retrieval system