KEGG   Rattus norvegicus (rat): 307212
Entry
307212            CDS       T01003                                 

Gene name
Cndp1
Definition
(RefSeq) carnosine dipeptidase 1
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00330  Arginine and proline metabolism
rno00340  Histidine metabolism
rno00410  beta-Alanine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    307212 (Cndp1)
   00340 Histidine metabolism
    307212 (Cndp1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    307212 (Cndp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    307212 (Cndp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     307212 (Cndp1)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M20
   307212 (Cndp1)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Other DBs
NCBI-GeneID: 307212
NCBI-ProteinID: NP_001007688
RGD: 1359493
Ensembl: ENSRNOG00000027739
UniProt: Q66HG3
Position
18q12.3
AA seq 492 aa
MLSPPHSGTLEKLFQYIDLHQDEFVQTLKEWVAIESDSVQPMPRLRQELFRMMALAADKL
RNLGARVDSVDLGSQQMPDGQSLPTPPIILAELGNDPKKPSVCFYGHLDVQPAQKEDGWL
TDPYTLTEVDGKLYGRGATDNKGPVLAWINAVSTFRALQQDLPVNVKFILEGMEEAGSVA
LEELVKREKDNFFSGVDYIVISDNLWLSQKKPALTCGTRGNCYFTVEVKCRDQDFHSGTF
GGILNEPMADLVALLGSLVDSSGHILVPGIYDQMAPITEEEKTMYENIDLDLEEYQKSSR
VERFLFDTKEELLTHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVLGKFSIRLVPHMTPSV
VETQVTQHLEAVFSKRNSFNKMAVSMVLGLQPWTANINGTQYLAARRAIQTVFGVDPDMI
QDGSTIPIAKIFQDITQKSVMMLPLGAVDDGEHSQNEKINRWNYIQGSKLFAAFFLELSK
LHSGQQVPSGAF
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgttatctcctccacactctgggacgctggagaagctcttccagtacatagacctccac
caggatgagtttgtgcagaccctgaaggaatgggtggccattgagagtgattctgtgcag
cccatgcctcgtctcagacaggagctcttccggatgatggccttagccgcagacaaactc
cggaacctgggagctagggtggattctgtagacctgggttctcagcagatgcctgacggt
cagagtcttcccacgcctcctatcatattggctgaacttggaaatgatcccaagaagccc
tccgtatgtttctatgggcacctggatgtgcagccagctcagaaggaggatgggtggctc
acggacccctacacactgacagaggtggatgggaaactgtatggacggggagcgacagac
aacaaaggccctgtcttggcttggattaatgccgtgagcaccttcagagctctgcagcag
gatcttcccgtgaacgtcaagttcatcctggaagggatggaggaagctggttctgtcgcc
ctggaggaactcgtcaaaagagaaaaagacaacttcttctctggtgtggactacattgtg
atttcagacaacctgtggctcagccagaagaagcctgcactcacttgtggaacccggggg
aactgctacttcacggtggaggtaaagtgtagagatcaagatttccattccggaaccttt
ggtggcatcctcaacgaaccaatggctgacctggttgctcttctaggtagcctggtagat
tcatcaggccacatcctagttcctggaatctatgatcaaatggcccctattacagaggag
gaaaagacaatgtatgaaaacattgatctggacctagaagaataccagaagagcagccgg
gttgaaagatttctgtttgataccaaggaggagctcctcacgcatctgtggagatacccg
tctctctccatccatggcatcgagggtgcatttgatgagcccggaactaaaacagtcatt
cccggccgcgtcctaggaaaattttcaatccgtctagtcccacacatgactccgtctgtg
gtagagacacaggtgacgcagcatctggaagcggtgttctcaaaaaggaatagtttcaac
aagatggctgtttctatggtactaggactccagccgtggactgcaaacatcaatggcact
cagtacctcgcagcacgaagagccatccaaacagtgtttggagtcgatcctgacatgatc
caggatgggtcaaccattccaattgctaaaatattccaggatatcacccaaaagagtgtg
atgatgctcccgctgggggctgtggacgatggagagcactcccagaatgagaagatcaac
aggtggaactacatacaagggtcgaaattattcgctgcctttttcctggagttgtcaaag
cttcattcaggacagcaggtgccttccggagcattctga

DBGET integrated database retrieval system