KEGG   Rattus norvegicus (rat): 307236Help
Entry
307236            CDS       T01003                                 

Gene name
Adnp2, RGD1308279
Definition
(RefSeq) ADNP homeobox 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain DUF4674 zf-C2H2_3rep Zn-C2H2_12 PRP21_like_P
Motif
Other DBs
NCBI-GeneID: 307236
NCBI-ProteinID: NP_001120845
RGD: 1308279
Ensembl: ENSRNOG00000053370
UniProt: B2GVB8
Position
18q12.3
AA seq 1136 aa AA seqDB search
MFQIPVQNLDNIRKVRKRVKGILVDIGLDSCKELLKDLKGFDPGEKYFCNTSWGDVSLWE
PSGKRAKYRTKPYCCSLCRYSTKVLTSLKNHLHRYHEEEADQELMIPCPNCPFASQPKVV
GKHFRMFHAPARKVQSYTVNILGEAKTSRSDVISFTCLKCNFSNTLYYSMKKHVLVAHFN
YLINSYFGLRTEETGEQPKASDPVSVDKALPFDKYYCKKCSAIASSQDALMYHILTSDAH
RDLENKLRSVISEHIKRTGFLKQMHIAPKPVTHIALPPNSSAPSIAAPPPCFQLALPQNS
QSPGTVQSVTVAPGTSGSLTHSPPTTAQSHVALVSSSLPVCQSSLTLQQSAPPPVFLSHS
VPLSQPVSTSVLPLTQPLGPVNKSVGTSLLPVNQAMCSVNQAVRPGVLPLPKPMGPINRP
VGPGVLPVGPSVNSGVLQATSPGVISVGRAVPSGVLPAGQVTPAGVIPGQTATSGVLPTG
QVVQSSVLPVGQTAPSRVLPPGQTVPLRVLPAGQVVPPGLLSPNQTVPSGVVPVNQGVNS
GVLQLSQPVTPGVLPVGPPVRPGVLQLSPSVSTSILPVSQPVRAGTSQNTTFLTSGSILR
QLIPTGKQVNGIPTYTLAPVSVTLPVPSAGGLAAVGPPPQVPVQFLPSSSGTQMGSSLPS
LPSPQVLVSPAPSVFVQATPPVADANQALRQAKQWKTCPVCNELFPANVYQVHMEVAHTQ
SEAKSSEKPEPERLAACAPFLKWMREKTVRCLSCKCLVSQEELMHHLLMHGLGCLFCPCT
FHDVRGLVEHSRTKHLGKKRLSMDYSNRGFQLDLDANGNLLFPHLDFITILPREKLGERE
VYLAILAGIHSKSLVPVYVKVRPQPEVAPKIPNRQKLTCPFCFGTFMAADAYELHLKERH
HVMPTVHTMLRSPAFKCIHCCGVYTGNMTLGAIAVHLLRCRSAPKDSSSDLQAQPDFIES
SELLMVNGEVIPESTFPLKRKLPEGHLGPEEQGDGDEPQLTVDTDASPGSEKGLSAVPLK
RQKNESRTEGSGASDDSLQVLALDPSKYGSRSYEEKKQFLRDYFHKRPYPSRKEVELLSS
LLWVWKIDVASFFGKRRYICMKAIKSHKPSVLLGFDMSELKNVKHRLNFECESENL
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattcctgtgcagaatcttgacaacatcagaaaggtgcggaagagggtgaaa
ggcatccttgtggacattggacttgacagctgcaaggagctgctgaaggatcttaaaggc
tttgatccgggagagaagtacttttgtaatacatcgtggggagatgtttctctttgggaa
ccttctggaaagagagcgaaatacagaacaaagccctactgctgtagtctctgcaggtac
tcaacgaaggtgctcacctccctcaaaaatcacctgcaccgataccacgaagaggaggct
gaccaggagctcatgatcccctgccccaactgcccgtttgcctctcagcccaaggttgtg
ggcaagcacttcagaatgttccacgcgcctgcgcggaaagtccagagctacacagtgaac
atcctgggtgaggcgaagacttcaaggagtgatgtgataagcttcacatgtttaaaatgt
aacttttcaaacactctgtactacagcatgaagaagcatgtgctggtggcccattttaat
tacttaattaactcctactttggattgcgaactgaggaaacaggagaacaaccgaaagca
agtgatccagtttctgtggataaagccctgccatttgacaagtactactgtaaaaaatgc
agcgccatcgccagtagtcaggatgccctgatgtatcacattctgacatcagatgcacat
agggacttggagaataagctgaggtctgttatctcagagcacatcaagaggaccgggttt
ctgaagcaaatgcatattgctccaaagccagtgacccacatagctttaccgccaaacagc
agtgctccgagcattgcagcccctcctccttgcttccagcttgctttgccacagaacagt
caaagtcccggcactgtgcagtcagtgactgtggccccaggcacttctgggagccttaca
cactcaccacctaccacggcccagtctcatgtagctctggtctccagctctttgcctgtg
tgccagagtagcctcaccctgcagcagtccgctcccccacctgtctttctctctcacagt
gtcccactgagtcagcccgtcagtacttctgtgctgcctctcactcagccacttgggcct
gtgaataagtctgttggaacaagcctcctccctgtgaaccaagccatgtgctccgtgaac
caagctgtccgccctggagttttacccctccctaagcccatggggcccataaacagacct
gtgggccctggtgtcttgcctgtgggtccctctgttaactcaggggttctccaggctaca
tctcctggggtgatttctgtaggtcgagcagttccatcaggagtccttcctgcaggtcag
gtgacccctgctggtgtgatccctgggcagacagccacttccggggtcttacccactggc
caggtggtccagtcgtcagttctccctgttggccagacagcgccatctcgagttctccct
cctggccagacagtgcccttgagggttctccctgcaggccaggtggtaccgcctgggctg
ctttctccaaaccaaactgtcccctcgggagttgtccctgtgaatcaaggtgtgaactct
ggtgttcttcagctcagtcagccagtaacaccaggagtccttcctgtgggcccacccgtg
aggcctggtgttctgcagctcagtccgtctgtcagcaccagcatcctgcccgtgagccag
ccggtgagagctggaacgtcccaaaacactactttccttacttcaggttctattctcaga
cagctcattccaactgggaaacaggtgaatggaatccccacctatacgctggccccagtg
tccgtcactctgccggtgccctccgctggaggccttgcagctgttggaccgccaccccag
gtgccagtgcagttcctgccctcaagctcgggcacacagatgggcagctccttgcccagc
ctgccctcgccacaggtgctagtgagccctgcccctagcgtgtttgttcaggctaccccg
cctgtggcagatgcaaatcaggcactcagacaggccaagcagtggaaaacatgcccagtt
tgcaacgagctcttccctgccaacgtctaccaggtccacatggaagtggctcacacgcag
agcgaggccaagtccagtgagaagcctgagcccgaaaggcttgctgcatgcgccccattt
ctgaagtggatgagagagaagacagtgcgctgcctctcttgtaagtgcctggtctcgcag
gaggagctgatgcaccatttgctcatgcatggcctggggtgcctgttctgtccatgcact
tttcatgatgtccggggccttgtggagcacagcaggactaagcacctgggcaagaagaga
ctgtctatggattacagtaacagaggtttccagctggacttggatgctaatgggaacctg
ctgttccctcatctcgatttcatcaccatactgccacgagagaaacttggagagcgagaa
gtgtacctggctatccttgctggaatacactccaagtcgttggtccctgtgtacgttaag
gtgaggcctcagcctgaggttgcaccaaagatacctaacagacagaagctgacctgcccg
ttctgttttggcacattcatggctgctgatgcctacgagctgcatctgaaggagaggcac
catgtcatgcccacagtccatacaatgctccggtctccggcctttaagtgcatccactgt
tgtggggtctacactggaaacatgaccttaggagccatcgctgtccatttgctccgttgt
agaagtgctccaaaggacagcagctcagacctgcaagcccagccagattttatcgagagc
agtgaactgctgatggtcaatggggaagtgatccccgagtccacctttcctctgaagaga
aagctgccagaaggccatttagggccagaagagcagggggacggggacgagccccagctc
acagtagacaccgatgcgagcccaggttcagagaaagggctgagtgctgtgcctttgaag
agacagaagaatgagagcaggacagaggggtcaggggccagtgatgactccctgcaggtg
ttggcgttagaccccagtaagtatggaagtcgttcctatgaggaaaagaaacagttcctc
agagactattttcacaagagaccatatcctagtcgaaaagaagtggaactactgtcctcg
ctcttgtgggtgtggaaaatcgacgtggcctcgttctttgggaaaaggaggtatatctgc
atgaaagcaataaaatcccacaagccctctgtacttctgggttttgatatgtctgagctt
aagaatgtcaaacacaggctgaactttgagtgtgagtcagaaaacctgtag

DBGET integrated database retrieval system