KEGG   Rattus norvegicus (rat): 307237
Entry
307237            CDS       T01003                                 

Gene name
Pard6g
Definition
(RefSeq) partitioning defective 6 homolog gamma
  KO
K06093  partitioning defective protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04144  Endocytosis
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    307237 (Pard6g)
   04390 Hippo signaling pathway
    307237 (Pard6g)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    307237 (Pard6g)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    307237 (Pard6g)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    307237 (Pard6g)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    307237 (Pard6g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    307237 (Pard6g)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     307237 (Pard6g)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 307237
NCBI-ProteinID: NP_001094443
RGD: 1305016
Ensembl: ENSRNOG00000055157
UniProt: A3F6Q3
Position
18
AA seq 382 aa
MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYQLVVHTHHISNTEV
TIGYADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEADHYSFGAGTLSRKKKVLVT
LRDEGLRRRAQLNISMPHDFRPVSSIIDVDILPETHRRVRLYRHGCEKPLGFYIRDGTSV
RVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANS
HNLIVTVKPANQRNNVVRSSRASGSSVQSTDSTTSHHSLPGTHALQNSEEMESDEEADIV
IEGALEPHHIPKMQAVPPGSLSRANGASLAHRLHRGDGGLHSSGRESNGSIHRFLSSLKP
DPRHSLVLPQGGVEEHGPAITL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaaccggagttttcataagtctcagaccctacgtttctacgactgcagcgcagtggaa
gtcaagagcaagtttggggccgagttccgaaggttctccttggaccgccacaagcctggg
aagtttgaagatttctaccagctggtggtgcacacccaccacatctccaacaccgaagtg
accattggctatgctgatgtacacggggacctgctgcccatcaacaatgacgacaacttc
tgcaaggccgtctcaagtgcgaaccccttgcttcgagtcttcatccagaagcgagaggag
gcagaccattacagcttcggagcaggcactctgtcgaggaagaagaaggtgctggtgacc
ctgagggatgagggtctgcgtcggcgtgcccagctcaacatcagcatgccgcacgacttc
cgcccggtgtcctccatcattgacgtggacatcctccctgagacgcaccgccgcgtgagg
ctttaccggcacggctgtgagaagccgctgggcttctacatccgagatggcaccagcgtg
cgagtgacaccccacgggctggaaaaggtaccagggatcttcatttcccgaatggtgccc
ggcggccttgcggagagcactgggctgctggctgtgaatgacgaagtcctggaggtgaat
gggattgaggtcgctggaaagacattggatcaagtcacggacatgatgatagccaacagc
cacaacctcattgtcactgtcaagcccgccaaccaaaggaacaatgtggtccgcagcagc
cgcgcctccggcagctctgtccagtccacagacagcaccaccagtcaccacagcctgcca
ggcacccacgccctgcagaattctgaggaaatggagagtgatgaggaggccgacatcgtc
atcgagggggctctagagcctcaccacattcccaagatgcaggctgtgcctccaggcagc
ctctcgagggccaatggcgccagcctggctcacaggctacacagaggggacgggggcctg
catagctctgggagggagagcaatggcagcatccacagatttctcagctctctgaaacca
gacccccgacacagcctggtcctcccccagggaggggtggaggaacacggaccggccatt
accctctag

KEGG   Rattus norvegicus (rat): 307799
Entry
307799            CDS       T01003                                 

Gene name
Pard6a
Definition
(RefSeq) partitioning defective 6 homolog alpha isoform 1
  KO
K06093  partitioning defective protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04144  Endocytosis
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    307799 (Pard6a)
   04390 Hippo signaling pathway
    307799 (Pard6a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    307799 (Pard6a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    307799 (Pard6a)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    307799 (Pard6a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    307799 (Pard6a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    307799 (Pard6a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     307799 (Pard6a)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 307799
NCBI-ProteinID: NP_001003653
RGD: 1303273
Ensembl: ENSRNOG00000017746
UniProt: A0A0G2JUC3
Position
19
AA seq 345 aa
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRTSVRGFQEFSRLLCVVHQIPGLDVLLG
YTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKREGDSSGLAFASNSLQRRKKGLLLRP
VAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRV
APQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHN
LIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDNSDPVIENRHPPCSNGLSQG
PLCWDLQPGCLLPSAGSSLPSLDSREQANSGWGNGMRGDVSGFSL
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggccaggccgcagaggactccggcgcgcagtccggatagcatcgtcgaggtgaagagc
aaatttgacgccgagttccgacgctttgcattaccccgcacttcagtgagaggctttcag
gagttctcgcggttgctgtgtgtggtacaccagatccctggcctggatgtgctgcttggc
tatacggatgctcacggtgacttgctgcccctcaccaatgatgacagtttgcaccgggcc
ttggccagcgggcccccacctctgcgcctgttggtccagaaacgggaaggtgactcgagt
ggcctggcttttgcctccaactctctacagaggcgcaagaaagggctcctgctacgacca
gtggcacctctgcgcaccaggccacccttgttaatcagcttgccccaagatttccgccag
gtgtcttcagttatagacgtggacctactacctgagacccatcgacgtgtgagactgcac
aaacatggctcagaccgtcccctgggcttctacattcgagatggcatgagtgttcgtgtg
gctcctcagggtctggagcgggtacctgggatcttcatctcccgcctggtccgtgggggc
ctggctgagagcacagggctgctggcggtcagtgatgagatcctcgaggtcaacggcatt
gaggtggccgggaagaccttggaccaagtgacggacatgatggttgccaacagccataac
ctcattgtcactgtcaagcctgccaaccagcgtaataatgtggtacgaggggcatctggg
cgtctgacagggccttcttctgtagggcctgggcctactgatcctgacagtgacgatgac
aacagtgacccggtcattgaaaatcgccaccctccctgttctaatgggctgtctcaggga
cccctgtgctgggacctgcaacctggctgcctacttcctagtgctggcagctctctgccc
tccttggatagcagagagcaagccaattctggctgggggaatggcatgcgaggtgatgtt
agtggattcagcctttga

KEGG   Rattus norvegicus (rat): 362279
Entry
362279            CDS       T01003                                 

Gene name
Pard6b
Definition
(RefSeq) partitioning defective 6 homolog beta
  KO
K06093  partitioning defective protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04144  Endocytosis
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    362279 (Pard6b)
   04390 Hippo signaling pathway
    362279 (Pard6b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    362279 (Pard6b)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    362279 (Pard6b)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    362279 (Pard6b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    362279 (Pard6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    362279 (Pard6b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     362279 (Pard6b)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 362279
NCBI-ProteinID: NP_001102079
RGD: 1308205
Ensembl: ENSRNOG00000010883
UniProt: D4A2F2
Position
3
AA seq 372 aa
MNRGHRHGVSSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRVFIQKKEEADYSAFGTDTLIRKKNVLSNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQAGASLEPEDQDSDEDDIIIEG
SGEPQQIPKATPEALSLESLTQIELSFESGQNGFSPLQDTSLVAVPSSLDTESESRAPDQ
KLLEEDGTIITL
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaaccgtggccacaggcacggggtgagcagcggctgcctgggcaccatggaggtgaag
agcaagttcggagctgagtttcggcggttttctctggaaagatccaagcccggaaagttt
gaggagttttatggactgctgcaacacgttcacaagatccccaacgttgacgtgctagtg
ggctacgcagacatccacggggacttgctgcccataaacaatgatgacaactaccacaag
gccgtttccactgccaacccactgctcagggtctttatacagaagaaggaagaagccgac
tacagcgcctttggcacggacaccctgatcaggaagaagaacgtgctgagcaacgtgctg
cgccccgacaaccacaggaagaagccgcacatcgtcatcagcatgccgcaggacttccgg
cccgtgtcatccatcatcgatgtggacatcctcccggagacgcaccgcagggtccgtctg
tacaagtacggcacagagaagcccctgggcttctacatccgggacggctccagcgtccgt
gtgacgccgcatggtttagagaaagttcccgggatcttcatctccaggctcgtccccggg
ggcctggcccagagcacgggcctgctggctgtcaatgacgaagttctagaagtaaatggt
atagaagtgtcaggcaagagcctggaccaggtgactgacatgatgatagccaacagccgt
aacctcatcatcacggtgcggccggccaaccagaggaacaacgtggtgcgtaacagtcgg
acttccggcagctccggccagtccaccgacaacagcctcctgggctacccacagcaggca
ggggccagcttggagccagaggaccaggacagcgatgaggacgacattatcattgaaggc
agtggtgagccgcagcagatcccgaaggccacccccgaggccctgagcctggagtccctg
acgcagatcgagctcagcttcgagtcggggcagaatgggttctcccctctccaggacacg
agcctggtggctgtccccagcagcctggacaccgagtcggaaagccgagctccggatcag
aaactcttagaggaagacggaacaatcataacgttgtga

DBGET integrated database retrieval system