KEGG   Rattus norvegicus (rat): 307343Help
Entry
307343            CDS       T01003                                 

Gene name
Fam210a, RGD1359600
Definition
(RefSeq) family with sequence similarity 210, member A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1279 Apolipoprotein YtxH LEA_4 CAAD
Motif
Other DBs
NCBI-GeneID: 307343
NCBI-ProteinID: NP_001007689
RGD: 1359600
Ensembl: ENSRNOG00000016740
UniProt: Q5XIJ4
Position
18q12.1
AA seq 273 aa AA seqDB search
MQWNVPRTMSRLALRTFLEAQKARLFDHHRSTKGLLLVHRGEYRVAWTPHLRKQWLHLSA
VQCLAKQRNLLDAQPPQRGALPQGRWEQDILSKRVLSSSSTSQETPSEKKEEPDPLQDKS
ISLYQRFKKTFRQYGKVLIPVHLITSGIWFGTFYYASIKGVNVIPFLEFLGLPDSVVDIL
KNSQSGNALTAYAMFKIATPARYTVTLGGTSFTVKYLRSHGYMSTPPPVKEYLQGRMEET
KELISEKMEETKDRLTEKLQETKEKVSFKKKVE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcaatggaatgtaccacggactatgtctcggctggcactcaggacattcttggaagca
cagaaagccaggctgtttgatcaccatcggagcacaaaaggactgttacttgtgcataga
ggtgaatacagagtggcttggacaccgcaccttcgaaagcagtggcttcatttatctgct
gttcagtgccttgcaaagcaaaggaatctgttagatgctcagccaccccaacggggggcc
cttccccaaggacgatgggagcaggatattttatccaagagggttttatcttccagttcc
acaagccaggaaactccgtcagaaaaaaaggaagaaccagatcctttacaagacaaatct
attagtctgtatcaacgatttaagaaaacatttaggcagtatggaaaagttttaattcct
gtgcatctaataacgtccgggatttggtttgggacattttactatgcatctataaaagga
gtgaatgtcatccctttcctagagttccttgggttacctgacagtgtagtagacatcctg
aaaaactcccaaagtgggaatgcactgacggcctacgccatgtttaagatcgccacgcct
gcccgctacactgtgaccctaggaggaacctccttcactgtgaagtatctgcgaagtcat
ggctacatgtcgaccccgccgcctgtcaaggagtatctgcagggcagaatggaagagacg
aaggagctcatctcagagaaaatggaggagacgaaggatagactcactgaaaagttacag
gaaaccaaagaaaaagtttcttttaagaaaaaagtggaataa

DBGET integrated database retrieval system