KEGG   Rattus norvegicus (rat): 307348Help
Entry
307348            CDS       T01003                                 

Gene name
Spire1
Definition
(RefSeq) spire-type actin nucleation factor 1
  KO
K02098  spire
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: KIND
Motif
Other DBs
NCBI-GeneID: 307348
NCBI-ProteinID: NP_001100851
RGD: 1305892
Ensembl: ENSRNOG00000025324
UniProt: D3ZEX7
Position
18q12.1
AA seq 749 aa AA seqDB search
MAQPSSPGGEGPQLGATGDPRDALSLEEILRLYNQPINEEQAWAVCFQCCGSLRAAARRQ
PHRRVRSAAQIRVIESLGIIIYKALDYGLKENEERELSPPLEQLIDQMANTSEADGSNDE
GYEAADEGPDEEDGERRSSAAIRSYQDVMKICAAHLPTESEAPNHYQAVCRALFAETMEL
HTFLTKIKSAKENLKKIQEMEKSDDCSTDLEDLKNADWARFWVQVMRDLRNGVKLKKVQQ
RQYNPLPIEYQLTPYEMLMDDIRCKRYTLRKVMVNGDIPPRLRKSAHEIILDFIRSRPPL
NPASARKLKPTPPRPRSLHERILEEIKAERKLRPVSPEEIRRSRLDVTTPESPKNVGKSS
VVNGDLTSQTKENGLGAAQPGPAQPKRLLKAPTLAELDSSDSEEETLHKSTSSSSASPSL
YEDPVLEAMCSKKKPPKFLPISSTPQPERRQPPQRRHSIEKETPTNVRQFLPPSRQSSRS
LVPRITSVWPRTPFRPLFSAIQTASLLSSHPFEAAMFGVAGAMYYLFERAFTSRWKPSKE
EFCYPVECLALTVEEVMHIRQVLVKAELEKYQQYKDVYTALKKGKLCFCCRTRRFSFFTW
SYTCQFCKRPVCSQCCKKMRLPSKPYSTLPIFSLGPSALQRGESCSRSEKPSTGHHRPLR
SITRFSSKSKSVDKSDEELQFPKEFMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRA
RLKRKTQSFYMSSAGPSEYCPSERTINEI
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagccctcaagcccgggcggcgaggggccgcagctcggcgcgacaggggacccg
cgcgacgcgctgagcttggaagagatcctgcggctctacaaccagcccatcaacgaggag
caggcgtgggccgtgtgcttccagtgctgcggctccctgcgcgccgccgcccgccgccag
ccccaccgccgcgtgcgctcggccgcgcagatccgcgttatcgaatccctgggaattatt
atttataaagcactggactatggcttgaaggaaaatgaagagagggagctgagccctcct
ctcgagcagctcatcgaccaaatggccaatacctcggaggcggatggaagcaatgatgaa
gggtacgaggcagcagatgaaggcccagacgaggaagatggagagaggagaagcagcgca
gccattcggtcctatcaagatgtcatgaagatatgtgctgctcatctccccactgagtcg
gaggcaccgaatcattatcaggcagtatgtcgggcactgtttgcagaaaccatggaactg
catacgtttctgaccaaaattaagagtgcgaaggagaaccttaagaagattcaagaaatg
gaaaagagtgatgactgtagcacagatctggaggacctgaaaaatgcagactgggcacgg
ttctgggtacaggtgatgagggatttgcgaaatggggtaaaacttaagaaagtccaacag
cggcagtacaacccattgcccattgaataccagctcaccccgtatgagatgctcatggac
gacattcggtgcaaaagatacaccttgagaaaagtaatggtaaatggtgacattccccct
cggttaagaaagagtgctcatgagatcatccttgacttcatcagatcaagacccccttta
aatccagcttcagccagaaaactgaaaccaaccccaccacggccacggagcctccatgaa
agaatactagaagaaattaaagcagaaagaaagcttcggcctgtctcaccagaagaaatt
agacggagcagactagatgttactacaccagaatctccaaagaatgtggggaaatcatct
gtggtgaatggagacttaacatctcaaacgaaagaaaatgggctgggtgctgcccagccg
gggcctgcacagccaaagaggctcctcaaagccccgacgctggctgagctggacagctct
gactctgaggaggaaactctgcacaagtcaaccagcagcagcagtgcatctccctccctc
tatgaggacccagtactggaggccatgtgctccaagaagaagcctccaaaattcttgccc
atctcatcaacaccccagcccgagagaaggcaaccaccacagaggcgccactccattgag
aaggaaactcctacaaatgtgaggcagtttctgcccccatccaggcagagctcacgttct
cttgttcctaggataaccagtgtatggccaaggacgcctttccgaccacttttctctgcc
atacaaacagcttctctgctgagctctcatccttttgaagcagccatgtttggggtagca
ggggctatgtattatctgtttgagagagcttttaccagcaggtggaaaccctcaaaggag
gaattctgctacccagtggaatgcctcgctctcactgtggaggaagtgatgcacattcgt
caggtcctggtgaaagcggagctggaaaagtaccaacagtataaggatgtctacactgcc
ctgaaaaaaggaaagctctgcttctgttgccgaacccggaggttttccttcttcacctgg
tcctacacctgtcagttctgtaagaggcccgtgtgctcacagtgttgcaaaaagatgcgg
ctgccttcgaagccatactccactttacctatcttctctttgggaccttctgccttgcaa
agaggggaaagttgttcgaggtcagaaaaaccttctactggtcaccatcggccgcttcga
agtattaccagattctcttcaaaatcaaagtctgtggacaaatcagatgaagaactccag
tttcccaaagagttcatggaagattggagcacaatggaggtgtgtgtagactgcaaaaag
ttcatttcagagatcatcagctcaagccggcgcagcctggtgttggccaacaaaagagcc
aggttgaaaaggaagacacagtctttctacatgtcctcagcgggcccctcggagtactgc
ccttcagaacggactatcaacgagatctga

DBGET integrated database retrieval system