KEGG   Rattus norvegicus (rat): 307366
Entry
307366            CDS       T01003                                 

Gene name
Malt1
Definition
(RefSeq) mucosa-associated lymphoid tissue lymphoma translocation protein 1 isoform X1
  KO
K07369  mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    307366 (Malt1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    307366 (Malt1)
   04660 T cell receptor signaling pathway
    307366 (Malt1)
   04662 B cell receptor signaling pathway
    307366 (Malt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    307366 (Malt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    307366 (Malt1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     307366 (Malt1)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C14: caspase family
   307366 (Malt1)
SSDB
Motif
Pfam: MALT1_Ig Ig_2 Ig_3 Peptidase_C14 I-set ig V-set Ig_4 Ig_5 Ig_6
Other DBs
NCBI-GeneID: 307366
NCBI-ProteinID: XP_003751846
RGD: 1309195
Ensembl: ENSRNOG00000017181
Position
18
AA seq 832 aa
MSLWGQPLQASPPPAVQQPLTASSGPSTAPPAGSTLNRLPEPLLRRLSESLDRAPEGRGW
RQLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVPELSDFLQALE
HTEVLQLLNPPGLKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPYGNSSE
LIFNTVHVKDAGFYVCRVNNNSTFEFSQWSQLDVCDVTEVSDSFQGSLDGVSESKLRICV
EPQSQKLAPGSALLLQCVAIGSPVPHYQWFKDESPLAHETKKHYTVPYVDLEHEGTYWCH
VYNDRDSQDSKKVEIIIGRTDGAVECTEDELNNLGRPDNKEQTGQPLAKDKVALLIGNMN
YWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYY
AGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDD
TIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEV
AEDMGKCHLTKGRQALEIRSSLSEKRALTDPIQGAPCSAEALVRNLQWAKAHELPESMCL
KFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVTDFPLDLDIDPKHANKGTPE
ETGSYLVSKELPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVSVGKPLI
AKLDMHRGLGRKTCLQACPMPDETCHSSTSTSAGAGHFHSSQDSFHDVYHSQLGNSDSAM
PPDRCHCSRTPHAFISNYPPHHYCQFGRSNVPVETTDEMPFSFSDRLMISEN
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgtcgctgtgggggcagccgctgcaggcctcgccgcctccggcggtgcagcagcccctg
accgcgtcttcgggaccttcgaccgcccctccagccggctcaactctcaaccgcctgccc
gagccgctgctgcggaggctcagcgagagcttggaccgcgcgccggagggccggggctgg
cggcagctggccgagctggcgggcagtcggggacgccttcggctcagttgcctggacttg
gaacagtgttctcttaaagtattggagccagagggaagcccaagtttgtgtttactgaaa
ctgatgggtgagaaaggatgtacagtcccagaactgagcgacttcctccaggctttggag
cacaccgaggttctgcagcttctcaaccccccaggattaaagatcaccgtaaacccagaa
tccaaggcagttttggctggacagtttgtaaaactgtgctgccgggcaactggacatcct
tttgtacaataccaatggttcaagatgaataaagagatcccatatggaaattcatcagaa
cttatttttaacacagtccatgtaaaagacgcaggcttttatgtctgccgagttaacaac
aactccacctttgaatttagccagtggtcgcagctggatgtgtgtgatgtgacagaagta
tcagacagcttccagggaagtctggatggcgtctcagaatccaagttgcgaatctgtgtt
gaaccacagtcccaaaagctggcgccaggcagtgcgttgctgttacagtgcgttgccatt
ggaagccctgtgccccactaccagtggtttaaagacgaatcaccattagcacatgagaca
aaaaagcattacacagtcccatatgtggatctagagcatgaaggaacctactggtgtcat
gtatataatgaccgggacagtcaagatagtaagaaggtagaaatcatcataggaagaaca
gatggggcagtggagtgcactgaagatgaattaaataatttggggcgtcctgataataaa
gaacaaactggccagcctttggcaaaggacaaagttgctcttttgataggaaatatgaat
tactgggagcaccccaagcttaaagctccattggtggatgtgtatgaattgaccaactta
ttaaggcaactagatttcaaagttgtttcattgttggatcttactgaatacgagatgtgt
aatgctgtggatgaattcttactacttttagacaaaggagtatatggcttgttatattat
gccgggcatggttatgaaaactttgggaacagttttatggtccctgttgatgctccaaat
ccgtataggtctgaaaattgcctctgtgtacaaaacatactgaaattaatgcaagaaaag
gagactggactgaatgtgttcctgttggatatgtgtcggaaaagaaatgactacgatgat
accattccaatcttggacgcactgaaagtcactgccaatatcgtgtttggatatgccacg
tgccaaggagcagaagcctttgaaatccagcattctggattggcaaatgggatttttatg
aaatttttgaaagatagattattagaagacaagaaaattactgtgttactggatgaagtt
gcagaagatatgggtaaatgccaccttaccaaaggcagacaagctctagagattcgcagc
agcttatctgaaaagagagcactgactgatccaatccagggagctccttgctctgcagag
gctctggtacgcaatctgcagtgggccaaggctcacgaactgccagagagtatgtgcctt
aagtttcagtgtggtgttcatattcagttaggatttgctgccgagttctccaacgtcatg
ataatctacacaagtatagtccacaagccacctgagataataatgtgcgacgcctatgtt
actgacttccctcttgacctagatattgatccaaaacatgccaataaggggactccagaa
gaaactggcagctacttagtgtccaaagagctccccaagcactgcctctatactagactc
agctcactacaaaaactaaaggaacatctgatcttcacagtctgtttatcctaccagtat
tcaggactagaagacactgtggaagagaagcaggaagtgagtgtcgggaaacctcttatc
gccaagttagacatgcatcgaggactgggcaggaagacttgcctccaagcctgtcccatg
cctgatgagacttgccacagctccacatctacctcagcgggagcagggcacttccattcc
tcccaagactccttccacgatgtgtaccattctcagctcggcaactcagacagtgctatg
ccaccagacaggtgccattgcagccggactccacatgcgttcatttccaactatcccccc
caccactactgccagtttggtagaagtaatgtgcctgtagagacgactgatgaaatgccg
ttcagtttttctgacaggcttatgatttctgaaaactga

DBGET integrated database retrieval system