KEGG   Rattus norvegicus (rat): 307380
Entry
307380            CDS       T01003                                 

Gene name
Piezo2
Definition
(RefSeq) piezo-type mechanosensitive ion channel component 2 isoform X1
  KO
K22128  piezo-type mechanosensitive ion channel component 1/2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    307380 (Piezo2)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    307380 (Piezo2)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    307380 (Piezo2)
Ion channels [BR:rno04040]
 Other channels
  Mechanosensitive channel (Piezo)
   307380 (Piezo2)
SSDB
Motif
Pfam: Piezo_RRas_bdg PIEZO
Other DBs
NCBI-GeneID: 307380
NCBI-ProteinID: XP_006254901
RGD: 1582973
Ensembl: ENSRNOG00000038784
Position
18
AA seq 2822 aa
MASEVVCGLIFRLLLPICLAVACAFRYNGLSFVYLIYLLLIPLFSEPTKATMQGHTGRLL
QSLCITSLSFLLLHIIFHITLASLEAQHRIAPAYNCSTWEKTFRQIGFESLKGADAGNGI
RVFVPDIGMFIASLTIWLVCRTIVKKPDTEEVAQFNSECENEELAGGEKMDSEEALIYEE
DLDGEEGMEGELEESTKLKMFRRLASVASKLKEFIGNMITTAGKVVVTILLGSSGMMLPS
LTSAVYFFVFLGLCTWWSWCRTFDPLLFGCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPP
NDYYARLFGIKSVIQTDCSSTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQEPL
VQEEMSKEEEGALDGCSNQNTAERRRSLWYATQYPTDERKLLSMTQDDYKPSDGLLVTVN
GNPVDYHTIHPSLPIENGPAKTDLYTTPQYRWEPSEESSEKKEEEEDKREDSEGEGSQEE
KRSVRIHAMVAVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYA
MISSPFMVVYANLLLVLQYIWSFELPEIKKVPGFLEKKEPGELASKILFTITFWLLLRQH
LTEQKALQEKEALLSEVKIGSQELDEKDEELQDIQVEGEPIEKEEEEEEIKEDRHEVKKE
EEEEEEDDDDQDIMKVLGNLVVALFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFC
VALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLG
LKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLKSIPSKEDNTIYSHAKVNGR
VYLIINRLAHPEGSLPDLAIMNMTASLDKPERQKLAEPGEERTEECAKKAEKGEAGKDSD
ESEEEEGEEEESEEEESSDLRNKWHLVIDRLTVLFLKFLEYFHKLQVFMWWILELHIIKI
VSSYIIWVTVKEVSLFNYVFLISWAFALPYAKLRRVASSVCTVWTCVIIVCKMLYQLQTI
KPENFSVNCSLPNENQTNIPLNELNKSLLYSAPVDPTEWVGLRKSSPLLVYLRNNLLMLA
ILAFEVTVYRHQEYYRGRNNLTAPVSKTIFHDITRLHLDDGLINCAKYFVNYFFYKFGLE
TCFLMSVNVIGQRMDFYAMIHACWLIGVLYRRRRKAIAEVWPKYCCFLACIITFQYFVCI
GIPPAPCRDYPWRFKGANFNDNIIKWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFED
ENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCRSYLDMSKVIIFSYLFWFVLTII
FITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSI
GACGYIGALVRNSCWLIQAFSLACTVKGYKMPEDDSRCKLPSGEAGIIWDSICFAFLLLQ
RRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIK
ARQQKYKKGKERMLSLTQESGEGQDIQKVSEEDDEREADKQKAKGKKKQWWRPWVDHASM
VRSGDYYLFETDSEEEEEEELKKEDEEPPRKSAFQFVYQAWITDPKTALRQRRKEKKKMA
REEQKGRRKGSGEGPVEWEDREDEPIKKKSDGPDNIIKRIFNILKFTWVLFLATVDSFTT
WLNSISREHIDISTVLRIERCMLTREIKKGNVPTRESIHMYYQNHMMNLSRESGLDTIDE
HSGAGSRAQAAHRMDSLDSHDSISSCYTEATLLISRQSTLDDLDGQDPVPKTSERARPRL
RKVFSMDMSSSSADSGSVASSEPTQCTMLYSRQGTTETIEEVEAEAEEEVVESLEPELHD
AEEKEYAADYEAGVEEVSLTPDEELPQFSTDDGDVEAPPSYSKAVSFEHLSFASQDDSGG
KNHMVVSPDDSRTDKLESSILPPLTHELTASDLLMSKMFRDDELEESEKFYVDQPRFLLL
FYAMYNTLVARSEMVCYFVIILNHMISASIITLLLPILIFLWAMLSVPRPSRRFWMMAIV
YTEVAIVVKYFFQFGFFPWNKDLEIYKDRPYFPPNIIGVEKKEGYVLYDLIQLLALFFHR
SILKCHGLWDEDDIVDSNTDKEGSDDELSLGQGRRGSSESLKSINLAASVESVHVTFPEQ
PAAIRRKRSCSSSQISPRSSFSSNRSKRGSTSTRNSSQKGSSVLSIKQKSKRELYMEKLQ
EHLIKAKAFTIKKTLQIYVPIRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWA
FGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGI
HFWMFFILPSVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYV
NLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQ
PRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQP
IFTMSAQQSQLKVMDGTKYNEFIKSFGPNSGAMQFLENYERQDITVAELEGNSNSLWTIS
PPSKQKMIQELTDPNSCFSVVFSWSIQRNMTLGAKAEIATDKLSFPLTDATRSSIAKMIA
GNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMNITIILFRDNVTKSNSEW
WVLNLTGSRIFNQGSQALELVVFNDKVSPPSLGFLAGYGIMGLYASVVLVIGKFVREFFS
GISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK
TN
NT seq 8469 nt   +upstreamnt  +downstreamnt
atggcttcggaagtggtgtgcgggctgatcttcaggctgctgctccccatctgcctggca
gtagcatgtgcattccggtacaatgggctctcctttgtctaccttatctacctcttgctc
attcctctgttctcagaaccaaccaaagcgacgatgcaaggacacacagggcggctgcta
cagtccctgtgcatcaccagcctctcctttctgctccttcacatcattttccacatcaca
ctggccagcctggaagctcagcaccgcatcgcacccgcttacaactgctcaacttgggaa
aagaccttccggcagatcggcttcgaaagcttgaagggagctgatgctggcaatggcatc
agggtgtttgtgcctgatatcgggatgttcattgcgagcctgaccatctggctggtctgc
agaaccattgttaagaaaccagacacggaagaagtagcccaatttaattccgagtgcgaa
aatgaagaattggctggaggagaaaagatggactcagaagaagcgctgatttatgaggag
gacttagatggggaagaaggcatggaaggcgagctggaagaaagcacaaagttaaaaatg
tttcgcaggctcgcctccgtcgcttccaagcttaaggagttcatcggcaatatgataacc
acggcgggcaaggtggtggtgaccatcctgttgggctcctctggcatgatgctgccatct
ttgacctcagctgtgtatttctttgtatttctgggtctgtgcacctggtggtcctggtgc
cgaacttttgacccattgctgtttggctgcctctgtgtcctgttggcaatcttcactgct
gggcacctgattggactttatctgtaccagtttcagttcttccaagaagcagtcccaccc
aatgactactatgcaaggttgtttggaatcaaatccgttattcaaacagactgctccagc
acctggaagatcatagtaaacccagacctgtcctggtatcaccatgccaaccccatcctc
ctgctggtgatgtactacacgctggccacgctgatccgcatttggttgcaagagcctctt
gtgcaggaggagatgtcgaaggaagaggagggtgcactggatggctgctccaatcagaac
acagcagagaggaggcggagcctgtggtatgcaacccagtacccaacagatgagagaaaa
cttttatccatgacccaagatgactacaaaccatctgatggcctgctggtgactgtgaac
ggcaaccctgtggactaccacaccatccacccaagtctgcccatagagaatggccccgcc
aagacggacttgtatactactcctcagtaccggtgggagccctcagaggagtcctcagaa
aagaaagaggaggaagaggacaagagagaagactcagaaggggaagggagccaagaggaa
aaacggagtgtgagaattcatgccatggtcgccgtgttccagttcatcatgaagcagagt
tacatctgtgccctcatcgccatgatggcatggagcatcacctaccacagctggctgaca
tttgtgctgttgatctggtcgtgcactctctggatgattcgcaacaggaggaagtacgcc
atgatcagctctccgttcatggttgtctatgccaatctgctgctggtactgcagtacata
tggagctttgaacttccagaaatcaagaaagtccctggatttctagaaaagaaagagcct
ggagagcttgcctcaaagatcctcttcaccatcacattttggctgctcctgaggcagcat
ctcacagagcagaaggcccttcaggaaaaggaagcacttctgtctgaagtcaaaattgga
agtcaagaacttgacgaaaaggatgaggaactccaagatatacaagtggaaggagagccc
atagagaaggaagaagaggaggaggaaataaaggaagacagacatgaggtaaagaaggaa
gaggaagaggaagaggaagatgacgatgaccaggacatcatgaaggttctgggcaatctg
gtggtggccctcttcatcaagtattggatctacgtctgcgggggcatgttcttttttgtc
agctttgaggggaaaatcgtcatgtacaaaatcatctacatggtgctgttcctgttctgt
gtggccttgtaccaggtgcactacgagtggtggaggaagatcctgaaatacttctggatg
tcggtggtcatttacaccatgctggtgctcatcttcatctacacttaccagtttgagaac
ttcccaggcctgtggcaaaacatgaccgggttaaagaaagagaagcttgaggatctgggc
ctgaagcagttcactgtggccgaactgttcacacgaatattcatccccacctcctttctg
ctggtctgcatcctgcacctccactatttccatgaccggttcctggaactcacagacctc
aagtccatccccagcaaagaagacaacaccatctacagccatgccaaggtcaatggtcgc
gtgtacctaataataaataggttagcccaccctgaaggaagcctcccagacctagccatt
atgaacatgacggccagcctcgataagcctgagaggcagaagttggcagagcctggggag
gagaggacagaagaatgtgccaagaaggcagagaagggtgaggctgggaaagacagtgat
gagtctgaggaggaggaaggtgaggaagaggaatccgaggaggaagaatcctcagatctc
aggaacaagtggcacctcgtgattgaccggctcactgtgctctttctaaagttcctggag
tatttccacaagttgcaggtgtttatgtggtggatcttggagctgcacatcatcaaaatc
gtctcatcgtacattatctgggtgactgtcaaagaggtgtctctgttcaactatgtattt
ttgatttcttgggcatttgctctgccatatgccaaactccgccgtgtggcttccagtgtc
tgcactgtctggacgtgtgtgatcatcgtctgcaaaatgttgtaccagctgcaaaccatt
aagcctgagaacttttctgtcaactgctccttgcccaatgaaaatcaaaccaacataccc
cttaatgagttgaacaagtctcttctctacagtgcccctgttgatcccactgagtgggtt
ggcctgaggaagtcctcccctttactcgtctacctgaggaacaacctcctgatgttggcg
attttggccttcgaagtcactgtttaccgacatcaggagtactatcgaggccgaaacaac
ttgactgctccggtgtctaaaactatctttcatgacatcacaaggttacatctagatgat
gggcttatcaattgtgccaaatattttgtaaactacttcttctacaagtttggcctagag
acctgtttcctaatgtcagtgaacgtaattggacagcgaatggacttctacgccatgatt
catgcctgttggctgatcggtgtcttgtaccgtcgcagaagaaaagccattgctgaggtc
tggcccaagtactgctgcttcctggcttgcatcatcaccttccagtactttgtctgcata
ggcatccctcctgccccctgccgagattacccatggaggttcaagggtgccaacttcaat
gacaacatcatcaagtggctgtacttcccagatttcatcgtgcggcccaaccctgtgttt
cttgtctatgacttcatgctgctcctgtgtgcttccttacaacgacagatttttgaggac
gaaaacaaggcagctgtgcgcatcatggccggggacaatgtcgagatttgcatgaacctt
gacgcggcctcattcagccagcataaccctgtaccagatttcattcactgcagatcttac
ttggacatgtccaaagtgatcatcttcagctacctcttctggttcgtcctcaccatcatc
ttcattaccggaacgaccaggatcagcatcttttgcatgggttacctggtggcctgtttc
tatttcctgctctttggaggtgatctgctcctgaaacccatcaagagcatcctacgctac
tgggactggctgattgcatacaacgtgtttgtgatcaccatgaaaaacatactgtcaata
ggagcctgtggatacatcggtgcactggtgagaaacagctgctggctgatccaagcgttc
agcctggcctgcacggtgaaaggctataaaatgcctgaagatgactccagatgcaagctg
cccagtggggaggcagggatcatctgggacagcatctgctttgcgtttctcctgctacag
aggagagtcttcatgagttactatttcctgcatgtcgtggctgacattaaagcatcccag
atcctggcatccagaggggccgaacttttccaggctacaattgtgaaagctgtaaaggca
agaattgaagaagagaaaaaatccatggaccagctgaagagacagatggatcgcatcaaa
gcccggcagcaaaagtacaaaaagggtaaggagaggatgctgagcttgacccaggagtca
ggggaaggccaggacatccagaaagtctcagaagaagacgatgaaagagaagcagacaaa
cagaaagccaagggcaaaaaaaagcagtggtggcggccttgggttgatcatgcttccatg
gtcaggagtggagattattatttgtttgaaacggatagtgaagaggaggaagaagaggaa
ctcaaaaaggaggatgaagaaccaccacggaagtctgcattccagttcgtctaccaagcc
tggattaccgatcctaaaacagcactccgacagaggaggaaagagaagaagaaaatggcc
agagaagagcagaagggaagacgcaaaggatctggggagggtccagtggaatgggaagac
agagaagatgagccaatcaaaaagaaatctgatggaccagataatatcatcaagaggata
tttaatatcctgaagttcacctgggtcctgttcctggccacagtggacagtttcactact
tggctcaactccatctcaagagagcatatcgacatatccacagttctgcggattgaaaga
tgcatgctgacccgagagataaagaagggcaacgttccgacacgggaaagcatccacatg
tactaccagaaccacatgatgaacctttccagagaatccggactggacacaatcgacgag
cactctggcgctggttccagggcccaggcagcacacaggatggatagcttagattcccat
gacagtatctccagctgttacactgaagcaaccctgctgatctcaaggcagtccaccctt
gatgatttagatggacaagaccctgttcctaaaacaagcgagcgtgctcggcctaggctc
cgtaaagtgttcagcatggacatgtcctcctcatcagctgacagtggcagtgtagcatca
agcgagcccacacagtgcaccatgctgtattcacgccaaggaactacggaaaccattgag
gaggtagaggctgaagctgaggaggaggtggtagagagtctggagcctgagctccatgat
gccgaagagaaggaatatgcagctgactatgaagcaggggtagaggaggtcagcctcact
ccagatgaggagttgcctcagttctcaacagatgacggtgacgtggaggccccgccctcc
tacagcaaggctgtcagctttgagcacctctcgtttgcatcacaagatgactccgggggc
aagaaccacatggtggtcagccctgacgacagccgcacagacaagctggagtccagtatc
ttaccgcccctgactcacgagctgacagccagcgatctgctcatgagcaagatgttccgt
gatgatgagcttgaagaatctgagaaattctacgtggaccagccccggttcttgctgcta
ttctatgccatgtataacactctggtagcccgctcggaaatggtgtgctatttcgtgatc
atcctgaaccacatgatctctgcctccatcattactcttctgttgcccatcctgatcttc
ctctgggccatgctgtccgtccccaggcccagccggcgcttctggatgatggccatcgtc
tacactgaggtggcgattgtagtgaaatatttcttccagtttggcttctttccttggaat
aaggacttggaaatttacaaggacaggccctactttccaccaaacatcataggggtggaa
aagaaagagggctatgttctttacgacctcattcagctgctggctctgttcttccatcga
tccattctgaagtgtcatggcctatgggacgaggatgacattgttgacagtaacacagac
aaggaaggatctgatgatgagctgtccctcggtcagggcagaagaggctcctcagagtca
ctgaagtccatcaacttggctgcctctgtagagtccgtccatgtgaccttcccagagcag
ccagcagccatccggagaaaacgctcctgcagcagctcgcagatctccccacggtccagc
ttctcttcaaataggtccaaaagaggcagcacaagcacccgaaacagcagccaaaaagga
agcagtgttttgagcattaaacaaaaaagcaaaagagaactttacatggaaaagcttcaa
gaacatttaatcaaagcaaaggcctttaccataaagaaaactctacaaatctatgtaccc
attcggcaattcttctatgacctcatccacccagactacagtgctgtgactgacgtgtat
gtgctgatgttcctggccgacaccgtggacttcatcatcatcgtctttggcttctgggct
tttgggaaacactcggcagctgcagatatcacctcttccctatcagaagaccaggtcccc
gggccattcctggtgatggttctcattcagtttggaaccatggtggtggaccgtgcactc
tacctcaggaagactgtgcttggcaaggtcattttccaggtcatcctcgtgtttggaatt
cacttctggatgttcttcatcctacccagtgtgactgagaggaaattcagccagaacctg
gtggcacagctctggtactttgtgaaatgtgtgtactttgggttgtctgcctaccaaatc
cgctgtggctacccaacacgtgtgctcggaaacttcctcacgaagagctacaattatgtc
aacctcttcttgtttcaagggtttcgtctcgtcccatttctgacagagctgcgggctgtg
atggactgggtgtggacagatacaaccttgagcctctccagctggatttgtgtggaggac
atttacgcacacattttcatcttaaagtgctggcgagagtcggaaaagagataccctcaa
cccaggggccagaagaagaagaaagctgtgaagtatggcatgggcggaatgatcattgtc
ctgctcatctgtatcgtctggtttcctctgctcttcatgtctttgatcaagtctgtcgca
ggggttattaaccaacccctggatgtgtccgtcacaataaccctgggaggctatcagcct
atcttcacaatgagtgcccagcaaagccagctgaaagttatggatggtacaaagtataac
gaattcataaagtctttcggccccaacagtggcgctatgcaatttctggagaattatgaa
aggcaagacataacagtagcggaactggaagggaattcgaattctttgtggaccatcagc
cctcccagtaagcagaaaatgatacaggagctcaccgaccccaatagttgcttctctgtt
gttttttcatggagtatccagagaaacatgactctgggtgcaaaggctgaaatagcaacg
gacaagctttcttttcctctcacggatgcgacacgaagtagcatagccaaaatgattgct
ggcaatgacacagaaagttccaacacaccagtgacaatagaaaagatctacccatactat
gtgaaggcacccagtgactcaaactcaaagcctataaaacagcttctgtcagaaaacaat
ttcatgaatatcaccatcattttgttcagagacaatgtcacaaagtccaatagtgagtgg
tgggttctcaacctgactggaagtaggatattcaatcagggatcccaagccttggagctg
gtggtcttcaatgacaaagtcagccccccaagtctgggcttcttggctggctatggcatc
atgggattgtatgcatccgttgtccttgtaattgggaagtttgttcgcgaattcttcagt
gggatttctcactctatcatgtttgaagagcttccaaatgtggacagaattttgaagtta
tgcacagatatatttctcgtacgggagacaggggaactggagctggaggaagacctctat
gccaaattgatattcctgtacaggtcgccagaaaccatgatcaagtggactagagaaaaa
acaaattga

DBGET integrated database retrieval system