KEGG   Rattus norvegicus (rat): 307398Help
Entry
307398            CDS       T01003                                 

Gene name
Arhgef37, RGD1560471
Definition
(RefSeq) Rho guanine nucleotide exchange factor 37
  KO
K20710  Rho guanine nucleotide exchange factor 37
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    307398 (Arhgef37)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    307398 (Arhgef37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_2 SH3_9 BAR SH3_1 SH3_3
Motif
Other DBs
NCBI-GeneID: 307398
NCBI-ProteinID: NP_001094444
RGD: 1560471
Ensembl: ENSRNOG00000025502
UniProt: A1IGU3
Position
18q12.1
AA seq 676 aa AA seqDB search
MADFETDEASSKSESPEQEGQGSEDKSLLHQRLAIRELIDTEVSYLHTLRLCTSDIRGHL
QQLPPGDLDILFSNIDDIIQVSSRFLHGLQETACKEEKQAHLIGNLFLEFQEELEQVYKV
YCANYDQALLLVKAYQKEPELQKEIQGIIEAAVPQAGPSGLSFLLVIPLQRITKYPLLLQ
KILENTPADASAHPVLQRATSALQDVNSNINEYKMRKEVALKYTKVEQLSLRERLARINT
HTLSKKTTRLSQLLKQEAGLVPRTEDKEFDDLEERFQWVSLCVTELKSNVAAYMDNLEAF
LCFRPHERNLDIPGGAAEQYCSLARDLQLQAFLQFKQRLTGLVWQPLCSLARALVGPQNL
IKKRLDKLLDFERVEEKLLDVGSVTYEEEAARHTYQALNSLIVAELPQFNHLVMQWLGQI
LRTFVVLQRDLADQVLRRAESSMALLPHRHVSEPDFQKLLEDTLGQSSSQLRHFRESFEK
VLPPSTSQPLLPGSEHQMQSLLTRYGPGKIYQVTSNINGTGTLDLTLPRGQIVALLQNKD
TKGNNSRWLVDTGGHRGYVPAGKLQLYHPINPSEKEPRRQTGMPEDYWLPTPEPTQPSVP
TVPTMSQVVAVYPFVARSTHELSLQAGQPVTILEAQDKKGNPEWSLVEANGQRGYVPSNF
LARTPSPTPRGWNLPS
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggctgactttgaaacagatgaggcctcttccaagtcagagagccctgagcaggaaggc
cagggttctgaggacaaatctctgctccatcagaggctggccatcagagagctcatcgac
acagaagtctcctacttgcacacactccgactctgtacctctgacatcagaggccaccta
cagcagctgccgccaggagatctggacatactgttctcaaacatcgatgacatcatccaa
gtgagcagcagattccttcacgggctgcaggagacagcctgcaaggaagagaaacaagca
cacttgattggtaacttattcctggaattccaagaggagcttgaacaagtctataaagtc
tactgtgccaactatgaccaggccctgctgctggtcaaggcataccagaaggagccggaa
ctccagaaggagatccagggcatcatcgaagctgcagtgccacaagctggaccttcgggt
ctcagtttcttacttgtaatccctctgcagaggattaccaagtaccccctcctgctgcag
aaaatcctggagaacacacctgcggatgccagtgcccaccctgtccttcagagagccacc
tctgccctccaggatgtgaacagcaatatcaacgagtacaagatgcgcaaggaagtggcc
ttaaagtataccaaagtggagcagctgagccttcgggagcggctggcccgcatcaacacc
catactctttccaagaagaccaccaggctgagccagctgctgaagcaggaggcggggctc
gtacccaggacagaagacaaggaatttgatgacttggaggagagattccagtgggtgtct
ctgtgcgtgacagagctgaagagcaatgtggcagcttacatggataatctggaggctttc
ctctgcttccggccacacgagcggaacctggatatccctgggggagctgcggaacagtac
tgcagcctagcgagggaccttcagctccaggccttcctgcagtttaagcagcggttaaca
ggcctggtgtggcaaccattgtgcagtctggccagagccctggttggccctcagaacttg
atcaagaaacgtctggacaaactcctggacttcgagagagtagaagaaaaactgttggat
gtgggcagtgtgacctatgaggaagaggcggcccggcacacgtaccaggcactcaactcc
ttgatagtggctgagctcccacagtttaaccacctcgtcatgcagtggctgggccagatt
ctgcgcacatttgtggtcctccagagagaccttgcagaccaagtgctgcgaagggcagag
agcagcatggccctgctgcctcatcgccacgtctccgagccggacttccagaagctgctg
gaggacacgctaggccagagcagtagccagctccgccactttcgggagagctttgagaaa
gtgcttccaccctccacctcgcagccactccttccagggtctgaacaccagatgcaatct
ctcctcaccagatatggccctgggaagatataccaggtgacaagcaacatcaatggcact
gggaccctggacctgacactgcctcggggccaaatcgtggcccttctacaaaacaaggac
accaaaggcaacaacagtcgctggctggtagacacagggggacaccggggatacgtgcca
gctggaaaacttcagctatatcaccctatcaatcccagtgagaaggagcccagacgccag
acagggatgcctgaagactactggcttccaaccccagagcccacccaaccctctgtcccc
actgtcccgaccatgagccaggtggtggccgtgtacccttttgtggccaggagcacccac
gagttgagtctacaggcaggccagcctgtgaccatcctggaagcccaagacaagaagggg
aacccagaatggagcctggtggaagcaaacggacagaggggatatgtaccttccaacttt
ctggccaggactccgagtccaactccccggggctggaatcttccctcttag

DBGET integrated database retrieval system