KEGG   Rattus norvegicus (rat): 307403
Entry
307403            CDS       T01003                                 

Gene name
Csf1r
Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor precursor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04151  PI3K-Akt signaling pathway
rno04380  Osteoclast differentiation
rno04640  Hematopoietic cell lineage
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    307403 (Csf1r)
   04014 Ras signaling pathway
    307403 (Csf1r)
   04015 Rap1 signaling pathway
    307403 (Csf1r)
   04151 PI3K-Akt signaling pathway
    307403 (Csf1r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    307403 (Csf1r)
   04061 Viral protein interaction with cytokine and cytokine receptor
    307403 (Csf1r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    307403 (Csf1r)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    307403 (Csf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    307403 (Csf1r)
   05202 Transcriptional misregulation in cancer
    307403 (Csf1r)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    307403 (Csf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    307403 (Csf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    307403 (Csf1r)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     307403 (Csf1r)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   307403 (Csf1r)
CD molecules [BR:rno04090]
 Proteins
  307403 (Csf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 307403
NCBI-ProteinID: NP_001025072
RGD: 2425
Ensembl: ENSRNOG00000018414
UniProt: D4ACA7
Position
18
AA seq 1022 aa
MELGAPLVLLLATAWHGVQILSGEKSRTTIHIYLLAGRRAVTTEIVLMGQRSTDVQRVND
CQGAPVIEPSGPELVVEPGATVTLRCVSNGSVEWDGPISPYWTLDSESPGSILITKNATF
KNTGTYRCTELEDPMRGSTAIHLYVKDPVRPWNLLAQEVTVFEGQEAVLPCLITDPTLKD
SVSLVREWGRPVSRKTVYSFLPWRGFIIHKAKFLDSHTYMCKAVVNARESTSIGIRLKVN
RAHPGPPHIILEPTKLVRIRGEAAQIVCSATHSEVEFNVILKRGDTKLEIPINSDFQDNA
YKKVLTLNLNAVDFQDAGIYSCVANNAAGSNTATMNFQVVESAYLNLTSEQSLLQEVSVG
ENLDLTVIADAYPGLQRYNWTYLGPFFEDPHNLEFRTQWTTYSYSFKLHLNRVKPLEAGR
YSLMAQNKAGWNNLTFELTLRYPPEVSVTWIPVNGSDVLLCDVSGYPQPNVTWMECRGHT
DRCDEAQASQVWDDTQPEVLSQKPFHRVILQSQLPIGTLKHNMTYVCRAHNNVGNSSQFF
RAISLGQSKQLPDEYLFTPVVVACISVMSLLVLLLLLLLYKYKQKPKYQVRWKIIESYEG
NNYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKML
KSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRK
AEAMLGPSLSPGQDPEGDSSYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFF
KQDLDKEASRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFG
LARDIMNDSNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPG
ILVNNKFYKLVKDGYQMAQPVFAPENIYSIMQSCWDLEPTKRPTFQQICFLLQEQARLER
REQDYANLPSSSSSSSSSSDSGGGSGGSSSEPEEESSSEHLACCEPGDIAQPLLQPNNYQ
FC
NT seq 3069 nt   +upstreamnt  +downstreamnt
atggagctgggggctcctctggtcctgctgctggccacagcttggcatggagtgcagatt
ttatctggggagaagagtaggaccaccatccacatctaccttctggcaggcaggagggcg
gtgaccactgagattgttctcatgggtcagaggagcactgatgtccagagggtcaatgac
tgtcaaggggcccctgtcatcgagcctagtggcccagagctggttgtagagccaggtgca
acagtgaccctgcgatgtgtgagcaatggcagtgtggaatgggatggccccatctctccc
tactggaccttggactctgaatctcctggaagcatcctgatcacaaaaaacgccaccttc
aaaaacactgggacctaccgttgtactgagcttgaagaccctatgcggggcagtaccgcc
atccacttgtacgtcaaagatcctgtccggccctggaatttgctagcacaggaggtgaca
gtgtttgagggccaggaagctgtgctgccctgtctgatcactgaccccacactgaaggac
agtgtctcactggtgagggagtggggcagaccagtctcacgcaaaacggtctactccttc
ttaccatggcgagggttcattatccacaaggctaaattccttgacagtcatacctacatg
tgcaaggctgttgtgaacgctagggaatccacctccattggcatccggcttaaggtgaat
cgagcccacccagggcccccacacatcatattggaacctactaagctggtgaggattcga
ggggaggctgcccagatcgtgtgctcggccactcactcagaagttgaattcaacgttatc
ctcaaacgtggagacaccaagttggaaatccccataaacagtgacttccaagacaacgct
tataaaaaggtcctgactcttaacctcaatgctgtggacttccaagatgctggcatatat
tcctgtgtggccaacaacgcagctggctcgaacacggccaccatgaacttccaggtggtg
gagagtgcctacttaaacttgacctctgagcagagcctcttgcaggaggtgtctgtgggt
gagaacctcgacctcacagtcattgcagatgcctaccctggcctacagcgttacaactgg
acctacctagggccgttctttgaagacccacacaatcttgagtttagaacccaatggacc
acatacagctactcattcaaactccacctgaaccgtgtaaagcccttggaggccggccgc
tactccttaatggcacaaaacaaggcaggctggaataatctgacctttgagctcaccctg
cgataccccccagaagtcagtgttacatggatacctgtgaacggctctgatgtcctgctc
tgtgatgtctctgggtatcctcagcccaacgtgacatggatggagtgcaggggccacacc
gataggtgtgatgaggcccaggcctcgcaggtttgggatgacacacaacctgaagtcctg
agtcagaagcccttccacagagtgatccttcagagccagctgcccattgggaccctaaag
cacaacatgacttatgtttgcagagcccacaacaatgtgggtaacagctcccagttcttc
agggccatctccctaggacaaagcaagcagctccctgatgagtacctgttcactccagtg
gtggtggcctgtatatctgtcatgtctctgctggtactactgctgctgctgctcttgtac
aagtacaagcagaagccgaaatatcaggtgcgctggaagatcattgagagctacgagggc
aacaactacaccttcatcgaccctacccagttgccctacaatgagaagtgggagtttccc
cggaacaacctgcaatttggtaagactctcggagctggtgcctttgggaaggtggtggag
gccacagcctttggtctgggcaaagaagatgcagtgctgaaggtggctgtgaagatgctc
aagtccacggctcatgccgatgagaaggaggccctaatgtcagaactgaagatcatgagt
cacctgggacagcatgagaacattgtcaacctcttgggagcctgtactcatggagggcct
gtcctggtcatcaccgaatactgctgctacggagaccttctcaacttccttcgaaggaag
gccgaggctatgctgggacccagcctgagtcctggtcaggaccccgagggggactccagc
tacaagaacatccacctggagaagaaatatgtgcgcagggacagtggcttctccagtcag
ggcgtagatacctatgtggagatgaggcctgtttcgacttcctcaaatgactccttcttt
aagcaagatctggacaaagaggccagccggccgctggagctctgggacctgcttcacttc
tctagccaagtggctcagggcatggctttccttgcttctaaaaattgcatccatcgtgat
gtagctgctcgaaatgtgctgttgaccagcggacatgtggccaagattggggactttggg
ctggctagggacatcatgaatgactctaactatgttgtcaagggcaatgcccgcctgcct
gtaaagtggatggccccagagagcatcttcgactgcgtctacacagttcagagtgatgtg
tggtcctacggcatcctcctctgggagattttctcacttggtctgaacccctacccaggc
atcttagtgaacaacaagttctacaaactggtgaaggatggataccaaatggcccagcct
gtatttgcaccggagaacatatacagcatcatgcagtcctgctgggacctggagcctacc
aaaagacctaccttccagcagatctgcttcctcctccaggaacaggcccgactggagagg
agagagcaggactatgctaacctgccaagcagcagcagcagcagtagcagcagcagtgac
agtggtggtggcagtggtggtagcagcagtgagcctgaagaggagagctccagtgagcac
ctggcctgctgtgagccaggggacatcgcccagcccctgctgcagcctaacaactaccag
ttctgctga

DBGET integrated database retrieval system