KEGG   Rattus norvegicus (rat): 307428
Entry
307428            CDS       T01003                                 

Gene name
Tnfaip8
Definition
(RefSeq) TNF alpha induced protein 8
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF758 DHquinase_I DUF2408 Pico_P2B PSP1 Adenine_deam_C EMC3_TMCO1 MRC1
Other DBs
NCBI-GeneID: 307428
NCBI-ProteinID: NP_001100857
RGD: 1305908
Ensembl: ENSRNOG00000026136
UniProt: D4A9G3
Position
18q11
AA seq 166 aa
MVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAEKVIKNLIKTVIKLAVLHRNNQFN
QDELALMEKFKRKVHQLAMTVVSFHQVEYTFDRNVLSRLLNECRELLHDIIQRHLTAKSH
GRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKMLDEENI
NT seq 501 nt   +upstreamnt  +downstreamnt
atggtatccaaatccatcgccaccaccctgatcgatgacaccagcagcgaggtcctggat
gagctgtacagggtgaccaaggagtacacccagaacaagaaggaggcagagaaggtcatc
aagaacctcatcaagacggtcatcaagctggccgttctccacaggaacaatcagttcaac
caagacgagctggccttgatggagaagttcaagagaaaggtgcaccagctggccatgacg
gtggtgagctttcaccaggtagagtacacctttgaccgcaacgtgctgtccaggctgctg
aacgagtgccgagagctcctgcacgacatcattcagcgccaccttaccgccaagtctcac
ggacgggttaataacgtctttgatcatttttcagattgtgattttttggctgccttgtat
aatccctttggaaaatttaaacctcacttacagaaactttgtgacggcatcaacaaaatg
ttggatgaagagaacatatga

DBGET integrated database retrieval system