KEGG   Rattus norvegicus (rat): 307475
Entry
307475            CDS       T01003                                 

Gene name
Gpr151, nGPCR-2037
Definition
(RefSeq) G protein-coupled receptor 151
  KO
K08435  G protein-coupled receptor 151
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    307475 (Gpr151)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    307475 (Gpr151)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 307475
NCBI-ProteinID: NP_853664
RGD: 727873
Ensembl: ENSRNOG00000027103
UniProt: Q7TSN5
Position
18p11
AA seq 421 aa
MGKATLAVFADSDSSNMNESFAHLHFAGGYLPSDSKGWRTIIPSLLAAVCLVGFVGNLCV
IGLLLHGVWKRKPSMIHSLILNLSLADISLLLFSAPVRATAYVKGVWDLGWFVCKSSDWF
THMCMAAKSLTFVVVAKVCFMYASDPAKPVGTHNCTIWSLLGAIWVVASLLPLPEWFFST
TRHHAGVEMCLVDVPAVAAEFMSLFGKLYPLLVFCLPLLLAGFYFWRAYNQCKIRCAKTQ
NLRNQMRSKQLTVMLLSTAVTSALLWLPEWIAWLWVWHLKAGGPMPPQGFIALSQVLMFS
ISTVNPLIFLMMSEEFKAGLKGIWKWMITRKPVVTSEVQEVPAGNIETLPGKAPSPETQT
CIPDTDRCGSPDSSKETTDKVMVPILPDVEQFWHERDVGPSAQDNDPIPWEHEGQETKGC
N
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggggaaggcaacgctggcagtctttgctgactccgattccagcaacatgaacgagtca
tttgctcacctccactttgcaggaggctacctgccatctgactccaagggctggaggacc
atcattccatctctcttggcggctgtgtgcctggtgggcttcgttggaaacctatgtgtg
attggccttctccttcatggtgtttggaaaagaaagccatccatgatccactccctgatt
ctcaatctcagcctggctgacatctctctcctgctcttttccgcacctgtccgagctacg
gcatacgtcaaaggtgtttgggatctaggctggtttgtctgcaagtcctctgactggttc
acccacatgtgcatggcagccaagagcttgacatttgttgtagtagccaaggtgtgcttc
atgtacgcaagtgacccagccaagccagtgggtacccacaactgcaccatctggtcactg
ctgggagccatctgggtggtagccagcctacttcccctgccagaatggttctttagcacc
accagacatcacgcaggtgtggaaatgtgcctcgtggatgtgccagctgtagcagcagaa
ttcatgtcactgttcggtaagctctaccctctgctggtgttttgccttcctttacttttg
gctggcttttatttctggcgagcttataaccaatgcaaaatacgctgtgcgaaaactcaa
aatcttaggaaccagatgcgttcaaagcaactcacggtgatgctgctgagtactgccgtc
acctctgctcttctgtggctccccgaatggatagcctggctgtgggtttggcatctgaag
gctggaggtccaatgccaccgcagggttttatagccctgtctcaagtcctgatgttttcc
atctccacagtgaatcctctcatatttctaatgatgtctgaagagttcaaggcaggcttg
aaaggcatatggaaatggatgataaccagaaagcctgtagttacctcagaggttcaggag
gtaccagctggaaacattgagacccttcctggtaaggctccatctccagagacccaaaca
tgcattccagacacagacagatgtggctctcctgactccagcaaagagacaactgacaag
gtgatggttcccatcctccctgatgttgagcagttttggcacgagagggatgttggccct
tcggcacaagacaatgaccctataccctgggaacatgaaggccaagagacaaagggctgc
aattag

DBGET integrated database retrieval system