KEGG   Rattus norvegicus (rat): 307483
Entry
307483            CDS       T01003                                 

Gene name
Diaph1, Diap1
Definition
(RefSeq) diaphanous-related formin 1
  KO
K05740  diaphanous 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04810  Regulation of actin cytoskeleton
rno04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    307483 (Diaph1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    307483 (Diaph1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    307483 (Diaph1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    307483 (Diaph1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Formins
     307483 (Diaph1)
SSDB
Motif
Pfam: FH2 Drf_FH3 Drf_GBD Drf_FH1 Drf_DAD DUF3450 Rootletin
Other DBs
NCBI-GeneID: 307483
NCBI-ProteinID: NP_001100863
RGD: 1310707
Ensembl: ENSRNOG00000019688
Position
18p11
AA seq 1265 aa
MEPSGGGLGPGRGTRDKKKGRSPDELPATGGDGGKHKKFTLKRLMADELERFTSMRIKKE
KEKPNSAHRNSSASYGDDPTAQSLQDISDDQVLVLFEQMLVDMNLNEEKQQPLREKDIVI
KREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMHLLSCLESLRVSLNNNPVSWV
QTFGAEGLASLLDILKRLHDEKEETSGNYDSRNQHEIIRCLKAFMNNKFGIKTMLETEEG
ILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMEEVERFQPLLD
GLKSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIDNDDMRV
QLNVFDEQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLV
RNDYEARPQYYKLIEECVSQIVLHKNGTDPDFKCRHLQIDIEGLVDQMIDKTKVEKSEAK
ATELEKKLDSELTARHELQVEMKKMENDFEQKLQDLQGEKDALDSEKQQITTQKQDLEAE
VSKLTGEVAKLSKELEDAKKEMASLSAVAVAPSVSSSAAVPQAPPLPGTSGTVIPPPPPP
PLPGGAVPPPPPPPLPAGTGIPPPPPLPGGACISSSPQLFGSTAIPPPPPLPGATAIPPP
PPLPGDTAIPPPPPLPGXTAIPPPPPLPGATGVPPPPPPLPGSVGVPPPPPLPGGPGLPP
PPPPFPGAPGIPPPPPGMGVPPPPPFGFGIPAAPVLPFGLTPKKVYKPEVQLRRPNWSKF
VAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTSKAKKDQEGGEEKKSVQKKKVK
ELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKML
SELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEEL
RKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELC
ETDHPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIADVERDVQNFPAATDEKDKFV
EKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQ
AVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQ
SGAAFRRKRGPRQVNRKAGCAVTSLLASELTKDDAVAASSAKVPKKSEGVTTILEEAKEL
VGRAS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atggagccgtccggcgggggcctagggcccggccgcgggacccgggacaagaagaagggt
cggagcccggatgagctgcctgcgacgggcggcgacggcggcaaacataagaaatttact
ttgaagcggctcatggcagacgagctggagagatttaccagcatgaggattaagaaggag
aaggaaaagcccaattctgctcatagaaactcctctgcatcgtatggagatgaccccact
gctcagtcactgcaggacatctcagatgatcaagttcttgtcctctttgagcagatgctg
gtggatatgaacctgaatgaggagaaacagcagcctttgcgagagaaggacattgtcatc
aagagggagatggtgtcccagtatctgcatacttccaaagctggcatgaaccagaaggag
agttccaggtctgccatgatgtacattcaggagctgaggtcaggcttgcgggatatgcac
ctgcttagctgcctggagtcccttcgagtctctctcaacaataaccctgtcagttgggtg
cagacatttggtgctgagggcctagcctccttattggacatcctcaaacgactccatgat
gagaaagaggagacttctggaaactacgacagccggaaccagcatgagattatccgctgt
ttgaaagctttcatgaacaacaagtttggaatcaaaaccatgttggagacggaagaagga
atcctactgctggtcagagccatggatcctgctgttcccaatatgatgattgatgcagca
aagctgctgtctgccctctgtatcctaccgcagccagaggacatgaatgaacgagtttta
gaggctatgacagagagagctgaaatggaagaggttgaacgcttccagccactgctggat
gggttaaaaagtgggacgtctattgcactcaaagtgggatgcctacagctgatcaatgct
ctcatcactcccgctgaggaacttgacttccgggttcacatccgaagtgagctgatgcgc
ttgggactgcatcaagtgttgcaggagcttcgagagattgacaatgatgatatgcgagta
cagctcaatgtgtttgatgaacaaggggatgaagatttcttcgatctgaagggacgactg
gatgatatccgcatggagatggatgactttggtgaagttttccagattattttaaacaca
gtgaaagattccaaggcagaaccacacttcctgtctatcttgcagcatctcctgttggtc
cgaaatgattatgaagctaggccgcagtactataaattgattgaagaatgtgtttctcag
atagttctacacaaaaatggaactgatcctgacttcaagtgccggcacctgcagattgat
attgaggggttggttgatcaaatgattgataaaacgaaggtggaaaaatctgaggccaaa
gctacagagctggaaaaaaagttggactcagaattaacagcccggcatgagttacaagta
gaaatgaaaaagatggaaaatgactttgagcagaaacttcaggatcttcaaggagaaaag
gatgccttggattctgaaaagcagcagatcactacacaaaaacaagacctggaagcagag
gtgtccaagctgacaggagaggttgccaagctgtcaaaagaactagaagatgccaagaag
gaaatggcttctctctctgctgtggctgttgcaccttcagtttctagtagtgctgctgtt
ccccaagcccctcctctgcctggcacttcaggcactgttattccacctcccccaccaccc
cctctccctggaggtgccgtcccaccccctcctcctcctcctctgcctgcaggtactggt
atccctccacctcctcctttacctggaggtgcttgtatatcctcttccccacagttgttt
ggcagtactgccattcccccacctcctcctttgcctggagctactgccatccccccacct
ccccctttgcctggagatactgccatccccccacctccccctttgcctggagntactgcc
atcccccctcctcctcctttgcctggagctactggtgtaccaccacctcctcccccttta
cctggaagtgttggtgttcccccaccccctcccttgcctggaggaccaggactgcctcct
cctcctcccccctttcctggagcacctggcattccccccccaccgcctggtatgggcgtg
cctccacctcccccctttggatttgggattcctgcagccccagttctgccatttggatta
acccccaaaaaagtttataagccagaggtgcaactccggaggccaaactggtccaagttc
gtggctgaggacctttcccaggactgcttctggacaaaggtgaaggaggaccgctttgag
aacaatgaactatttgccaaacttacccttgccttctctgcccagaccaagacttctaaa
gccaagaaggatcaagaaggtggagaagaaaagaaatctgttcaaaagaagaaagtaaaa
gagctgaaagtgctggattcaaagacagcccagaatctctcaatctttttgggttcattc
cgtatgccctatcaagagattaagaacgttatcctggaggtgaatgaggctgttctcacg
gagtctatgatccagaacctcattaagcagatgccagaaccagagcagttaaaaatgctt
tctgaactgaaggaggagtacgatgatctggctgagtcagagcagttcggcgtggtgatg
ggcacggttccccgtcttcggcctcgcctcaatgccatccttttcaagctacagttcagt
gagcaagttgagaatatcaagccagagattgtatctgtcactgcggcatgtgaggagctg
cgtaagagtgagaacttctctagcctcctggagctcacactgctcgttggaaactatatg
aatgcgggctccaggaatgctggagcttttggcttcaatatcagcttcctttgtaagctt
cgagacaccaagtctgcagatcagaagatgactctgttgcatttcttggctgagttatgt
gagactgaccaccccgatgtcctcaagtttcctgatgagcttgcccatgtagagaaagcc
agcagagtttctgctgagaacttgcagaagaatttagatcagatgaagaaacagattgct
gatgtggaacgcgatgttcaaaatttcccagctgccacagacgaaaaagacaagtttgtt
gagaagatgactagctttgtgaaggatgcacaggaacagtataacaagctacggatgatg
cactccaacatggagactctctataaggagctaggcgactacttcgtctttgaccctaag
aagttgtctgtagaagaattttttatggatctgcacaactttaggaatatgtttttgcaa
gcagtcaaggagaaccagaagcgccgggaaacagaagaaaagatgaggagagcaaaacta
gccaaggaaaaggcggaaaaagagcgactggagaagcagcagaagcgagagcagctcata
gacatgaatgcagagggggatgagacaggtgtgatggacagtcttctagaagctctgcag
tcaggagcagcattccgacggaagagagggccccggcaggtcaacaggaaagctgggtgt
gcagtcacatctctgctagcctcggagctgaccaaggatgatgccgtggctgctagttct
gctaaggtgcccaagaaaagtgaaggagtcaccacaatccttgaagaagccaaggaactg
gttggccgtgcaagctaa

DBGET integrated database retrieval system