KEGG   Rattus norvegicus (rat): 307503Help
Entry
307503            CDS       T01003                                 

Gene name
Etf1
Definition
(RefSeq) eukaryotic translation termination factor 1
  KO
K03265  peptide chain release factor subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    307503 (Etf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    307503 (Etf1)
   03012 Translation factors [BR:rno03012]
    307503 (Etf1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     307503 (Etf1)
Translation factors [BR:rno03012]
 Eukaryotic type
  Release factors
   307503 (Etf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eRF1_2 eRF1_3 eRF1_1 acVLRF1 baeRF_family10 Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 307503
NCBI-ProteinID: NP_001008345
RGD: 1305712
Ensembl: ENSRNOG00000019450
UniProt: Q5U2Q7
Position
18p12
AA seq 437 aa AA seqDB search
MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTAS
NIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPI
NTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKH
GRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSD
MFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGK
YCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDK
ETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQ
GMEYQGGDDEFFDLDDY
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaccccagtgctgccgataggaacgtggagatctggaagatcaagaagctc
attaagagcttggaggcggcccgcggcaatggcacgagcatgatatcactgatcattcct
cccaaagaccagatttcacgagtggcaaaaatgttagcagatgagtttggaactgcgtct
aacattaagtcacgagtaaaccgcctttcagtcctgggagccatcacatctgtacaacag
agactcaaactttataacaaagtacctccaaatggtctggttgtttactgtggaacaatt
gtaacagaagaaggaaaggaaaagaaagttaacattgactttgaacctttcaaaccaatt
aacacatcattgtatttgtgcgacaacaagtttcatacagaggctcttacagcgttactc
tcagatgacagcaagtttggttttattgtaatagacggcagtggtgctctttttggcacg
ctccaaggaaacaccagagaagtcctgcacaaattcactgtggatctcccaaagaaacac
ggcagaggaggtcaatcagccttgcgttttgcccgtttaagaatggaaaagcgacataac
tatgttcggaaagtagcagagactgctgtgcagctgtttatttctggagacaaagtgaat
gtggctggtttggttttagccggatcagctgactttaaaactgaactaagtcaatctgac
atgtttgaccagaggttgcaatctaaagttttaaaattagttgatatatcctacggtggt
gaaaatggattcaaccaagctattgaattgtctactgaagttctctccaacgtgaagttc
attcaagagaagaaattaataggacgatactttgatgaaattagccaggacacgggcaag
tactgttttggagttgaagacacactgaaggctttggaaatgggagctgtagagattcta
atagtctatgaaaatctggatataatgagatacgtgcttcattgccaaggcacagaagag
gagaaaattctctatttaacgccagaacaagagaaggataaatctcacttcacagacaaa
gagactggacaggaacatgagctgatagagagcatgcccctcttggaatggtttgctaac
aactataaaaaatttggagctacactagaaattgtcacagataagtcacaagaaggatca
cagtttgtgaaaggatttggtggaattggaggtatcttgcggtaccgagtagatttccag
ggaatggaataccaaggaggagatgacgaattttttgaccttgatgactactag

DBGET integrated database retrieval system