KEGG   Rattus norvegicus (rat): 307545
Entry
307545            CDS       T01003                                 

Gene name
Elp2, Statip1
Definition
(RefSeq) elongator acetyltransferase complex subunit 2
  KO
K11374  elongator complex protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    307545 (Elp2)
   03036 Chromosome and associated proteins [BR:rno03036]
    307545 (Elp2)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA modification factors
   Elongator complex
    307545 (Elp2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    Elongator complex
     307545 (Elp2)
SSDB
Motif
Pfam: WD40 RAB3GAP2_N
Other DBs
NCBI-GeneID: 307545
NCBI-ProteinID: NP_001029317
RGD: 1306419
Ensembl: ENSRNOG00000015301
UniProt: Q496Z0
Position
18p12
AA seq 821 aa
MVSSVLEVSYVFCCPNRARGALSWNSGPGGLLAFGTSCSVVLYDPQKKVVITNLNGHTAR
VNCLHWIRTEDGSPSTELVSGASDNRVIHWELENNQVLKSVRLQGHEGPVYAVHGIYQSG
PSDGEQHALIASAASDSTVRLWSKKGSEVKCLQILKFGDGFVLTVCLSTLPDTDAPVLAC
GDDGGRIHLFVQQDDWFQKMLSLCGHEDWIRGVEWATFGRDLFLASCSQDCLIRIWRLYM
KPTSLETEDGSIRLKENTFTIKDGGVSTTVAVILETVLAGHENWVNAIHWQPSFYKDGVL
HQPVRLLSASMDKTMILWAPDEESGVWLEQVRVGEVGGNTLGFYGCQFGENGSMIIAHAF
HGAMHLWKQSTVNPRQWAPEIVISGHFDGVQDLIWDPEGEFIITTSTDQTTRLFAPWKKK
NQSQVTWHEIARPQIHGYNLKCLAMIDRFQFVSGADEKVLRVFSAPRNFVENFSVISRQS
LSHMLYDEDNDLPEGATVPALGLSNKAVFEGDMTYLTSEEEELLSPAFGYPQVIFQPAVL
SEPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNNSKTLLASACKAAQKEHAAIILWSTT
SWKQVQSLAYHTLTVTQMAFSPDDKFLLAVSRDRTWSLWKRQDVTSAEFDPFFSLFAFTN
KITSVHSRIIWSCDWSPDSKYFFTGSRDKKVVVWGECNSSYNPMEHPINPCSSILDVGSC
VTAVSVCPVLNPAQRYIVAVGLESGKICIYSWSKTNQETKDWTSCVETTPSQSHTLGIRR
LCWKSCSGSTEQSEEGTEWLDFASCGEDHTVKIYRVNRCAL
NT seq 2466 nt   +upstreamnt  +downstreamnt
atggtttcttctgtgttggaggtgtcttatgtgttttgctgcccgaaccgggctcgagga
gctttgagttggaattccgggcccggagggctcctggccttcggcacatcctgctccgtt
gttctctatgaccctcagaaaaaggtagttattaccaatctgaatggtcataccgctcga
gtcaactgcctacactggatacgtacagaggatggctccccgtccacagagctggtgtct
ggagcttctgacaatcgggtgattcactgggaactggagaacaatcaggttttaaaatca
gtccgtctccaaggccatgaaggaccggtttatgctgtgcatggtatttaccagagcggg
ccatccgatggcgagcagcatgccctgatagcttctgcagcttccgattccacagttcga
ctctggtctaaaaaggggtctgaagtgaaatgccttcagatcttgaaattcggggatgga
ttcgttctgactgtctgcctgtccactttgcctgatactgatgcgccagtgttagcatgt
ggtgatgatggcggcagaattcacctgtttgttcagcaggatgactggtttcagaaaatg
ctttctctgtgcggacacgaggactggataagaggcgtggaatgggcaaccttcggtaga
gaccttttcctggcaagctgttcacaggattgcctcataagaatatggagactgtatatg
aaaccgacatctttagaaactgaggacggtagcataagactgaaggaaaatacattcact
ataaaagatggcggtgttagcacgacggttgcagttatcctggagacagtgctggctgga
catgaaaactgggtgaatgccattcactggcagccttcgttttacaaagatggcgttctg
caccagccagtgagattgctgtctgcctccatggacaaaaccatgattctttgggctcca
gatgaagagtcaggggtttggttagagcaggtccgagtaggtgaagtaggtggaaatacc
ctggggttctatggttgccagttcggtgaaaatggctccatgatcatcgctcatgccttc
cacggagcaatgcacctttggaaacaaagcacagtaaatccacggcagtgggctccagag
atcgtcatttcaggacacttcgatggtgtccaagacctaatttgggatccagagggagag
ttcatcatcaccaccagcaccgatcagacaactcgcctttttgccccgtggaagaagaag
aaccaatctcaggtgacgtggcatgagatcgcaaggcctcagatacatgggtacaacctc
aagtgtttggcgatgattgatcggtttcagttcgtgtctggagcagatgaaaaagttctc
cgtgttttttctgctcctcggaattttgtggaaaattttagtgtcatttctcgacagtcg
ctgagtcacatgctctatgatgaagacaatgatcttccagaaggagccactgttcctgca
ttaggactatcaaataaagctgtctttgagggagacatgacctacctgacttctgaagag
gaggagctcttaagccctgccttcgggtatccccaggtgatctttcagcctgccgtcctc
agtgaaccccccactgaggaccaccttctgcagaacaccctgtggcctgaggttcagaaa
ctgtatggacatggctatgagatattttgtgttacttgtaacaattcaaagactctactt
gcctctgcatgcaaggcggctcagaaggaacacgcagctatcattctttggagcacgaca
tcttggaaacaagtgcagagtcttgcttaccacactctgaccgtcacacagatggccttc
tcgcctgatgacaagttcttactggctgtttccagagatcgaacctggtctttgtggaag
agacaggatgtgacctcagcggagtttgatccgttttttagtctttttgcattcaccaac
aaaatcacttctgtgcatagtagaatcatttggtcttgtgactggagtcctgatagcaag
tacttcttcactggaagtcgagacaagaaggtggtggtctggggcgagtgtaactccagc
tataaccccatggagcaccccattaatccctgctcctcgatcctggatgtgggcagttgt
gtgacagctgtcagtgtctgccctgtgcttaacccagcccaaagatacattgtggcagtt
ggattggagagtgggaagatttgtatatactcctggagcaagaccaatcaagaaaccaaa
gactggactagctgtgtagaaacaactccaagccaaagtcacacgctgggtatcagaagg
ttatgctggaagagctgcagcggcagcactgagcagagtgaagaggggaccgagtggttg
gattttgcaagctgtggcgaggaccatactgtgaagatttatagggttaacagatgtgca
ctgtga

DBGET integrated database retrieval system