KEGG   Rattus norvegicus (rat): 307616Help
Entry
307616            CDS       T01003                                 

Gene name
Cmtm2a, Cklfsf1
Definition
(RefSeq) CKLF-like MARVEL transmembrane domain containing 2A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL 7TMR-DISM_7TM
Motif
Other DBs
NCBI-GeneID: 307616
NCBI-ProteinID: NP_001013160
RGD: 1307501
Ensembl: ENSRNOG00000025420
UniProt: Q6AYN6
Position
19p14
AA seq 167 aa AA seqDB search
MASGIRYAFRPKGAQRKEDTTPKKGIRRYLFELKEGNKQFWLSGHAVTKLITLGCIITAL
DYFESMLPHPVLVLVLSMEVAIYIFFIFLNTFAINRYITFIFWPMTDLLNSLFSCVFLAG
SVFFAFKARRTLPKPYLTAMIFMGVAAISCFLDIFLQLPHFRGLQMR
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaggaataaggtatgcatttcggcccaaaggagctcagcgcaaggaggacacg
acccccaaaaaagggattcgacgctatctgtttgaactgaaagagggcaataaacagttc
tggctgtcgggacacgccgttacaaagcttataactttgggctgcataatcactgcacta
gactactttgaatcaatgctcccacatcctgttctggtcctggtcctcagtatggaagtg
gcaatctacatattcttcatcttccttaatacctttgccatcaaccggtacattaccttc
atcttctggcctatgacagatctattgaacagcctgttctcctgtgtgttcctcgcaggc
tctgtattctttgctttcaaggctagacgaacattgccaaagccctacttaactgctatg
atcttcatgggagttgctgcaatctcttgtttcctcgatatttttcttcaactcccacac
ttcagaggccttcagatgaggtaa

DBGET integrated database retrieval system