KEGG   Rattus norvegicus (rat): 307618
Entry
307618            CDS       T01003                                 

Gene name
Cdh5
Definition
(RefSeq) cadherin-5
  KO
K06533  cadherin 5, type 2, VE-cadherin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04670  Leukocyte transendothelial migration
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    307618 (Cdh5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    307618 (Cdh5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    307618 (Cdh5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    307618 (Cdh5)
   04090 CD molecules [BR:rno04090]
    307618 (Cdh5)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Major cadherins
   307618 (Cdh5)
CD molecules [BR:rno04090]
 Proteins
  307618 (Cdh5)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_3 Cadherin_pro Cadherin_2 Stevor
Other DBs
NCBI-GeneID: 307618
NCBI-ProteinID: NP_001100877
RGD: 1307370
Ensembl: ENSRNOG00000013324
Position
19
AA seq 776 aa
MQRLTELATALGTFLGLLAVAAMAGPNMLPVHQRQKRDWIWNQMHIDEEKNESLPHYVGK
IKSNVNRQNAKYVLQGEQAGKIFRVDADTGDVLAYERLDREKVSEYFLTALIVDKKTNKN
LEQPSSFTVKVHDVNDNWPVFTHQVFNASVPEMSAIGTSVIRVTATDADDPTVAGHATVL
YQMVKGNEYFAIDNSGLIFTKDKNLDRETRAEYKIVVEAQDAQGLRGESGTATVLIRLED
INDNFPIFTQSTYTFSVPEDIRVGKPLGSLSVEDPDEPQNRMTKYSIMQGEYRDTFTIET
DPDRNEGIIKPTKPLDYELIQQYTFHIEATDPTIRLGYLSSTAGKNKAKIIINVLDVDEP
PVFQRRFYHFHLPENKKKPLIGTVVAKDPDKAQRSIGYSIRKTSDRGQYFRITKQGNIYN
EKELDRETHAWYNLTVEANELDSRGNPVGKESIVQIYIEVLDENDNAPEFAQPYEPKVCE
NAAQGKLVVQISATDKDVVPVNTKFKFALKNEDSNFTLINNHDNTANITVKYGQFNREHT
KFHYLPVLISDNGMPSLTGTGTLTVAVCKCNEQGEFTFCEEMAAQAGVSIQALVAIFLCI
LTITVITLLIFLRRRLRKQAHAHSKSALEIHEQLVTYDEEGGGEMDTTSYDVSVLNSVRT
GSNKPLRSTMDARPAVYTQVQKPPRLAPSLHGGPREMATMIEVKKEEADNDGGGPPYDTL
HIYGYEGTESIAESLSSLSTNSSDSDIDYDFLNDWGPRFKMLAELYGSDPQEELII
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgcagaggctcacagagctggccactgctttgggcaccttcttgggcctgctggcagtg
gcagcgatggcaggccccaacatgctgcctgtccaccagcgccaaaagagagactggatt
tggaatcaaatgcacatagatgaagagaaaaatgagtcgctgccccactatgtgggaaag
atcaagtccaatgtgaaccgtcagaatgctaagtatgtgctccaaggagaacaagctggc
aagatcttcagggtcgatgctgacacaggggatgtgcttgcctatgagaggttagaccgg
gaaaaagtctctgagtacttccttactgccctcattgtggacaagaagaccaacaaaaac
ctggaacaaccttccagcttcactgtcaaggtgcatgatgtaaatgacaactggcctgtg
tttacgcaccaggtattcaacgcatctgtgcccgagatgtcagctatagggacctctgtc
atccgtgtgacagcaacggatgcagatgaccctacggtggctggccacgccactgtcttg
taccaaatggtgaaaggaaatgagtacttcgccatcgacaattctggactcattttcaca
aaggacaaaaacttggacagagagacacgggctgaatacaagatcgtggtggaagcacaa
gatgcccagggtctgcggggagagtcaggcacagccactgtgctgatcagattggaagac
atcaatgacaacttccccatctttactcagtccacatacacattttcggtgcctgaagat
atccgtgtgggcaagcccttgggctctctctctgttgaggacccagatgagcctcagaac
cggatgaccaaatatagcatcatgcagggcgagtacagggacaccttcaccattgagaca
gaccccgaccgtaatgagggtatcatcaaacccacaaagcccctggactatgaactcatc
cagcagtacacgttccacatcgaggccacagaccccactatcagactcggatacctgagc
agcactgcgggcaaaaacaaagccaagatcatcatcaatgtcctagatgtggatgagccc
cctgtcttccagcgacgcttctaccacttccacctgcccgaaaacaagaagaaaccactg
attggcactgtggtggccaaagaccccgacaaggctcaacgcagcataggatactccatc
cgcaagaccagtgacagaggccaatacttccgaataaccaaacaagggaacatctataat
gagaaagaactggacagagaaacccacgcctggtataacctgactgtggaggccaacgaa
ttggattctaggggtaaccctgtaggtaaagaatccattgtacagatttacattgaagtt
ttggatgagaatgacaacgccccagaatttgcccagccctacgaacctaaagtatgtgag
aatgctgcccagggcaagctggtagtacagatctctgcaacagacaaggacgtggtgcca
gtaaacacaaagttcaagtttgccctgaagaacgaggacagcaacttcaccctcatcaac
aaccacgacaataccgccaacatcacagtcaagtatggacagtttaatcgggagcatacc
aagttccactacctgcctgtgctcatctccgacaatgggatgcccagcctgactggaacc
ggcacgctaacagtggctgtgtgcaaatgcaacgaacagggcgagttcaccttctgtgag
gagatggccgcacaggcgggtgtcagcatccaggcactggtagccatctttctgtgcatc
ctcaccatcacagtgatcaccttgctgatcttcctgcggaggcggctccggaagcaggcg
catgctcatagcaagagtgcgcttgagattcatgagcagttggtcacctacgacgaggag
ggcggtggcgagatggacaccacaagctacgacgtgtctgtgcttaattctgtgcgcacc
ggctccaacaagcctctgcggtccacgatggatgcccggccagcagtatacacacaggtg
cagaagcctccacgactggcgcctagcctgcacggagggcccagagagatggccaccatg
atcgaggtgaagaaagaagaggcagacaatgatggcggtggtcccccctacgatacactg
cacatctacggctacgagggcacagagtccatcgcagagtccctcagctccctgagcacc
aattcctccgactctgacatcgactatgacttcctcaatgactggggacccaggttcaag
atgctggcagagctgtatggctcagatcctcaggaagagctcatcatctag

DBGET integrated database retrieval system