KEGG   Rattus norvegicus (rat): 307652
Entry
307652            CDS       T01003                                 

Gene name
Fam192a, Nip30, RGD1307433
Definition
(RefSeq) family with sequence similarity 192, member A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: FAM192A_Fyv6_N DinB
Other DBs
NCBI-GeneID: 307652
NCBI-ProteinID: NP_001014036
RGD: 1307433
Ensembl: ENSRNOG00000017841
UniProt: Q6AY90
Position
19p13
AA seq 254 aa
MDGGDDGNLVIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEAYDPRSLYERLQE
QKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELEELKEYRSNLN
KVGISAENKEVEKKLAVKPIETRSKFSQAKLLAGAVKHKSSESGNSVKRLKPDPDPDDKA
QEAPSCMSLGSSSLSGAPSLHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKI
VSSIFRTNTFLEAP
NT seq 765 nt   +upstreamnt  +downstreamnt
atggatggaggggatgatggtaaccttgtcatcaaaaagaggtttgtgtctgaggcagaa
ctagatgagcggcgcaaaaggaggcaagaagaatgggagaaagttcgaaaaccagaggac
ccagaagaatgtccagaggaggcgtatgacccccggtctctgtacgaacggctgcaggaa
cagaaagacaggaagcagcaggagtatgaggagcagttcaaattcaaaaacatggtaaga
gggttagatgaagatgagaccaacttcctcgacgaggtttctcggcagcaggagctgata
gagaagcagcgacgagaagaagagctggaggagctgaaggagtacagaagtaatctcaac
aaggttggaatttctgcagaaaataaggaagtagagaagaagctggctgtgaaacccata
gaaaccaggagcaagttctcccaggcaaagctgttggcaggagctgtgaagcataagagc
tcagagagtggcaatagtgtgaaaagactgaaaccagaccccgacccagatgacaaggct
caagaggccccgagctgcatgtctctgggaagctcttctctgagtggagccccctccctc
cactgcccgtctgctgctgtgtgcattggtatccttcctggcttgggtgcctactctggg
agcagtgactccgaatccagttcagacagcgaaggcaccatcaacgctacagggaagatc
gtctcctccatcttccgaaccaacaccttccttgaggcaccctag

DBGET integrated database retrieval system