KEGG   Rattus norvegicus (rat): 307715
Entry
307715            CDS       T01003                                 

Gene name
Irx6, RGD1564830
Definition
(RefSeq) iroquois homeobox 6
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Homeobox_KN Homeodomain Prothymosin
Other DBs
NCBI-GeneID: 307715
NCBI-ProteinID: NP_001095883
RGD: 1564830
Ensembl: ENSRNOG00000011037
UniProt: D4A7R4
Position
19p11
AA seq 443 aa
MAFPPFGHPYGGASQFLVSASSSATCCETAPRSVSDVASASTSASTLCCAPYDSRLLGSA
RPELGAALGIYGAPYAAAQSYPGYLTYGPEPPTLCGALNPQYEFKDAAGSFTPSLTQPGA
YYPYETTLGQYQYDRYGGVELSSAGRRKNATRESTSALKAWLHEHRKNPYPTKGEKIMLA
IITKMTLTQVSTWFANARRRLKKENKMTWVPKNKGGEERKADGGGEDALGCLNGDTKDAT
ASQEAQGLQLSDLEDLEEEEEEEEEEEAEKEEAAVSAARRLVGFPKSAQPLPAPCAAAQE
GCLESTECGLAVPRFSFTEAPQSGEADFITAEPSGPTMIVHYPSGHKPRIWSLAHTAASS
AVKGAPSTPPRGQSPECHMIPRQPSSVRRLLVPRFSGGEENSPAVKAFGNSTFALQGLPL
NCAPCPRRREPEVRFQYPSGAEG
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggccttcccgccctttggacacccgtatggcggcgcatcccagtttctggtgtctgca
agttccagtgccacttgctgtgaaacggcccctcggtcagtgtcagatgtggcctcagcc
tccacctctgcctctactctttgctgtgcaccctatgacagtcggctgctgggcagtgct
cggccagagctgggcgctgccttgggcatctatggagcaccttatgcagctgcccagagt
tacccagggtacctgacctatggcccagagccacctacactgtgtggtgcactgaatcct
cagtatgagtttaaggatgctgcaggaagctttactcccagtctgacccagccaggggcc
tactacccctatgagacaactctggggcagtatcaatatgacaggtatggtggagtggag
ttgagcagcgctggccgcaggaagaatgccacaagagagagcaccagcgcactgaaggcc
tggctccacgaacaccgcaagaacccgtaccccactaagggcgagaagatcatgctggcc
atcatcaccaagatgaccctcacccaggtgtccacctggttcgccaacgcgcgccggcgc
ctcaagaaggaaaacaaaatgacgtgggtgcccaagaacaagggtggggaggagaggaaa
gcagatggtggaggagaagacgctctggggtgcctgaatggtgacaccaaagacgctact
gccagccaagaggcccaggggctgcagctgagtgacttggaagatctggaggaagaggag
gaagaggaggaagaggaagaagcagaaaaagaggaggcagcggtctcagcagcacggagg
ctggttggttttccgaagagcgcacagcccttgcctgctccctgtgctgccgctcaggag
ggctgcttggagagcacagagtgcggcttggctgtgccccgcttctcctttactgaagcc
ccacaatcaggggaagctgactttattacagcagagccaagtggccccacgatgatcgtg
cactacccaagcggccacaaaccccgcatttggtccttagctcacactgcagcatccagc
gctgtcaaaggtgctccctcaactccgcccaggggacaaagtccagagtgccacatgatt
cccagacagcccagttctgtcaggcgactcctggtccccagattctcgggaggcgaagaa
aattctcctgcagtcaaagctttcggaaactccacgttcgctctgcaggggctgccactg
aactgtgcaccatgcccgaggcggagagagcctgaagtgcgcttccagtacccatctgga
gcagaaggttag

DBGET integrated database retrieval system