KEGG   Rattus norvegicus (rat): 307806
Entry
307806            CDS       T01003                                 

Gene name
Thap11
Definition
(RefSeq) THAP domain containing 11
  KO
K23211  THAP domain-containing protein 11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    307806 (Thap11)
   03036 Chromosome and associated proteins [BR:rno03036]
    307806 (Thap11)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2CysHis zinc factors
    307806 (Thap11)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   Transposable elements
    307806 (Thap11)
SSDB
Motif
Pfam: THAP DUF2722 Med15 CPSF100_C DUF702 ABC2_membrane_2 Spt20 Suf Presenilin Ctr Neur_chan_memb RNA_pol_Rpc4 DUF4834 eIF-3_zeta Roughex
Other DBs
NCBI-GeneID: 307806
NCBI-ProteinID: NP_001100892
RGD: 1310268
Ensembl: ENSRNOG00000019109
UniProt: D3ZHX2
Position
19q12
AA seq 308 aa
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRL
CSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQ
QQQQQQQSPSSSTAQTAQLQPNLVSASAAVLLTLQAAVDSSQAPGTVVPAPTTSSGDDVK
PIDLTVQVEFAAAEGAAAAAAASELEAATAGLEAAECTLGPQLVVVGEEGFPDTGSDHSY
SLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMA
VIRKKHGM
NT seq 927 nt   +upstreamnt  +downstreamnt
atgcctggctttacgtgctgcgtaccgggctgctacaacaactcacaccgagacaaggcg
ctgcacttctacacgtttcccaaggacgctgaactgcggcgcctctggctcaagaacgtg
tcccgtgctggcgtcagtgggtgcttctccaccttccagcccaccacgggccaccgtctc
tgcagcgttcacttccagggcggccgcaagacctacacggtgcgcgttcccaccattttc
ccgctgcgtggcgtcaatgagcgcaaagtagctcggagacctgcgggagctgcggcagcc
cgccgtaggcagcagcagcagcagcagcaacaacaacaacagcagcagcagcagcaacag
cagcaacagcagcagcagcagtctccgtcctcctccactgcccagactgcccagttgcag
ccgaatctggtgtctgcctctgcggccgtgcttcttactcttcaggccgccgtagacagc
agccaggctcctggaaccgtggttccagcgcccactacttcctcgggagatgatgtgaag
cccatcgaccttacagtgcaagtagagtttgcagctgctgaaggggcagccgccgctgcc
gccgcatcagagctagaggctgctacagctgggctggaggccgctgagtgcactctgggc
cctcagctggtggtagtaggggaagagggcttccctgatactggctccgaccactcatac
tctttgtcgtccggtaccacggaggaggagctcctgcgcaagctgaatgagcagcgggac
atcttggccctgatggaagtgaagatgaaagagatgaagggtagcatccgccatctgcgt
cttaccgaggccaagctccgtgaagaacttcgagagaaggatcgcctgcttgccatggct
gtcatccgtaagaagcacggaatgtga

DBGET integrated database retrieval system