KEGG   Rattus norvegicus (rat): 307986
Entry
307986            CDS       T01003                                 

Gene name
Nhlrc2
Definition
(RefSeq) NHL repeat containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: NHL Thioredoxin_8 SGL Arylesterase
Other DBs
NCBI-GeneID: 307986
NCBI-ProteinID: NP_001100914
RGD: 1307348
Ensembl: ENSRNOG00000016948
UniProt: D3ZLM5
Position
1q55
AA seq 725 aa
MAVPGARGASLSGLLPAQTSLEYALLDAVTQQEKDDLVYQYLQKVDGWEQDLAVPEFPEG
LEWLNTEEPLSIYRDLCGKVVILDFFTYCCINCIHVLPDLHALERTFSDTDGLLIVGVHS
AKFPNEKVLDNIKSAVLRYNITHPVVNDTDASLWQELEVSCWPTLVILGPRGNLLFSLIG
EGHKDKLFSYTSIALKYYKDRGQIRDGKIGIKLFKESLPPSPLLFPGKVAADPTTGRLVV
ADTGHHRILVLQKNGQIQYSIGGPNPGRKDGVFSESSFHSPQGVAIADNVIYVADTENHL
IRKIDLEAEKVSTVAGIGVQGTDTEGGEEGDKQPISSPWDVALGTSGSKVQRNDILWIAM
AGTHQIWAFLLDSGTLPKKSDLKKGTCLRFAGSGNEENRNNAYPHKAGFAQPSGLALAPE
EPWSCLFVADSESSTVRTVSLRDGAVKHLVGGERDPMNLFAFGDVDGAGISAKLQHPLGV
AWDEKRHLLYVADSYNHKIKVVDPNTKVCTTLAGTGDANDASSSFAESAFNEPGGLCIGE
RGRLLYVADTNNHQIKVMDLEARTVSVLPVFKSDSAVVDGSFPREKQKTVPKVPKSAPNI
SLPPVTVHPGQALQLGLRLELPPGAKLTEGAPSGWFLKAEGNEWLLQEQIPSGDIENISN
QPAISLQIPTECLSLEAVVSVTVFLYYCSADSSACMMKGVVFRQPLQINSVQPACAAPVE
LTYAF
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggcggtccccggagcgcgcggcgcgagtctctcgggtcttctgcccgcgcagacctct
ctagagtacgccctgctggacgccgtcacccagcaggagaaggatgacctggtctatcag
tatctgcagaaggtggacggctgggagcaggacctagcggtgcctgagtttccggaagga
ctagaatggctgaatacagaagagcctttgtcgatttacagagacctgtgtgggaaagtg
gtcatcctcgacttcttcacttactgctgcatcaactgcatccatgtgctgcccgatctc
cacgccctggagcgcacgttctctgacacagatggccttctgattgtcggtgttcactca
gctaagtttccaaatgaaaaggtcctggacaacatcaagagtgctgtccttcggtacaac
atcacccaccctgtggttaacgacacagatgctagcctttggcaggagcttgaagtctcc
tgctggccaacactggtcatactgggaccccgtggaaacctgctgttttctttgattgga
gagggtcacaaagataaactgttttcatatacatctattgctttaaagtattacaaagac
agaggacagatcagagatggaaaaattgggataaaactctttaaagagtctttgccgcct
tcaccattgctgttccctggcaaagtagccgcagaccctactactggtcggctggtggta
gcagacaccgggcaccacaggatcttggttcttcagaagaacgggcagattcagtacagt
attggaggacctaatcctggaaggaaagatggggtgttttcagagtcgtcttttcattct
ccacagggtgtagctatcgcagataatgtcatctatgtggccgacactgaaaaccacctt
ataagaaagatagacttagaagctgagaaggtgagcactgtagctggcatcggtgttcaa
gggacagatacagaaggcggtgaggagggagacaaacagcccatcagctccccgtgggac
gttgcacttgggacctcaggttcaaaggtccaaagaaatgacatcctgtggatagccatg
gcagggactcatcagatatgggccttcctcctggactctggcacactgccaaagaaaagt
gacctaaagaaaggaacctgcctccgttttgctggaagtggaaatgaagagaaccgaaac
aacgcatatcctcacaaggcgggcttcgcccagccatcaggcctcgctctcgctccagaa
gagccctggagctgcctctttgtggctgacagcgagagcagcactgtgaggactgtctcg
ctgagagacggagccgtgaaacacctcgttggcggagagcgagaccccatgaatttattt
gcttttggtgatgttgatggagcaggcatcagtgcgaagcttcagcacccacttggggtt
gcatgggatgagaagaggcatctgctctatgtggccgactcctacaatcacaagattaaa
gttgtggatccaaacacaaaagtctgtacaacgttagcaggcactggagatgcgaatgac
gccagttccagttttgcggagtcggcctttaatgagccgggaggcttgtgtatcggtgag
cgtggtcggctgctctatgtagcagacactaataatcaccagattaaagtgatggattta
gaagcaagaacagtttctgtgctccctgtcttcaagtctgacagtgctgtggtagacggc
tccttccctagagagaaacagaagacagtgcccaaagtgccgaagtccgccccaaatatc
agcctcccccctgtgacagtgcatccgggccaggctctgcagctcgggctccggctagag
cttccgccaggagcaaagctgacagaaggtgcccccagcggctggttcctgaaagctgaa
ggcaatgaatggcttcttcaggaacagatcccatctggagacatagagaatatttccaat
cagccggcaatctccctgcagatccctactgagtgcttgtccctggaggccgtggtgtct
gtcaccgtgtttctttattactgcagtgctgacagcagtgcatgtatgatgaagggagtt
gtgttcaggcagcctttgcagataaacagtgtccagccagcgtgtgcagctcctgtggag
ctcacgtacgcattctag

DBGET integrated database retrieval system