KEGG   Rattus norvegicus (rat): 308003Help
Entry
308003            CDS       T01003                                 

Gene name
Rab11fip2, RGD1308538, Rab11-FIP2
Definition
(RefSeq) RAB11 family interacting protein 2
  KO
K12484  Rab11 family-interacting protein 1/2/5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    308003 (Rab11fip2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    308003 (Rab11fip2)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    308003 (Rab11fip2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 RBD-FIP
Motif
Other DBs
NCBI-GeneID: 308003
NCBI-ProteinID: NP_001100917
RGD: 1308538
Ensembl: ENSRNOG00000009523
UniProt: D3ZD48
Position
1q55
AA seq 512 aa AA seqDB search
MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVW
KEEASFELPGLLMQGNPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF
RLESKQGKRIKNRGEIKVNIQFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKSDGVF
SDTSSAIVPSTHMPDANPEFSSGEMQMKSKPKKPFLLGPQRLSSAHSMSDLTGSHLSSEK
LKSSTVGPTHLLSHQINSFGVVPESGSLKSPHRRTLSFDTSKLNQPGSIVDEGEHCFGRQ
SDPFTNVTASLPQKFATLPRKKNPFEESSEPWDSSTNLFSKPIEVRKESKREKREKVSLF
ERVTGKRDSRRSDKLNNGGSDSPCDLKSPSAFNENRQDYFEYESTNPFTAKFRASTIMPS
SSFHMNPTSSDDLRKIPDSNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDY
IDNLLVRVMEETPSILRVPYEPSRKAGKFTNS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgtctgagcaagcccaaaagtggtttccaacccacgtgcaggtcacagtgctc
caagctaaagatctgaagccaaaaggcaaaagtggcaccaatgacacatacaccataatt
cagttgggcaaagagaagtattctacatctgtagcggagaaaaccctggagccggtctgg
aaggaggaggcctcttttgagctgcctgggttgctcatgcagggtaatccggagaaatac
attctttttcttatagtgatgcacaggtccctggtgggactggataagtttttagggcag
gtggcaatcaatctcaatgacatctttgaggacaaacaaagaaggaaaacagagtggttt
agattagaatcaaaacaaggaaaaagaataaaaaacaggggtgagataaaggtcaatatt
caatttatgaggaacaacatgacagcaagcatgtttgacttgtcaatgaaggacaagacg
agatcaccttttgcaaaattaaaagataagatgaaaggcaggaaaagcgacggggtgttt
tctgatacgtcctctgccatcgttccgagcactcacatgcctgatgccaatcctgagttt
tcaagtggtgaaatgcagatgaaatccaaaccaaaaaagccttttcttctgggtcctcag
cggctctcttctgcccattcgatgtctgatttaactgggtcccacttatcttctgagaag
ctgaagtctagcactgtaggcccaacacatcttctcagtcaccagataaattcctttgga
gttgttccagaaagtggaagtctcaagtctccacacagacgaacactaagctttgatact
tctaaattgaaccaacctggcagcattgtggatgaaggtgaacactgttttggaagacag
agtgacccatttacaaatgtgactgcttcattaccccaaaaatttgcaacactgccaagg
aagaagaatccatttgaagaaagcagtgagccatgggacagcagcacgaatttattttca
aaaccaattgaagtcaggaaagaaagtaagagagagaaaagggagaaggtgagcctcttt
gaaagagtgactgggaagagagatagcaggagatctgacaagctgaacaatgggggatct
gatagcccatgtgacttgaaatcacctagtgcttttaatgaaaaccggcaggactatttt
gaatatgagtcaaccaacccgtttacagcaaaattcagggcttcaactataatgccatct
tcaagttttcatatgaatccaacaagcagtgatgacctcaggaaaatcccggatagcaat
cccttcgatgccacggctgggtaccggagtctgacctacgaagaggtgctgcaggagctg
gtgaagcacaaagaactccttcggaggaaggacacccacatccgggagctagaggactac
atcgacaacctccttgtcagggtgatggaagagacacccagcatcctgcgagtgccctat
gagccatccaggaaagctggcaagtttaccaatagctag

DBGET integrated database retrieval system