KEGG   Rattus norvegicus (rat): 308015
Entry
308015            CDS       T01003                                 

Gene name
Clca1
Definition
(RefSeq) calcium-activated chloride channel regulator 1 precursor
  KO
K05027  calcium-activated chloride channel regulator 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04924  Renin secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    308015 (Clca1)
  09154 Digestive system
   04972 Pancreatic secretion
    308015 (Clca1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    308015 (Clca1)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   308015 (Clca1)
SSDB
Motif
Pfam: CLCA VWA_2 VWA VWA_CoxE
Other DBs
NCBI-GeneID: 308015
NCBI-ProteinID: NP_001100919
RGD: 1306258
Ensembl: ENSRNOG00000060831
UniProt: A0A0G2JWX9
Position
2
AA seq 910 aa
MGSLKSPVFLLVLYLLEGVLSNSLIQLNNNGYEGIVIAIDHDVPEDEALIQRIKDMVTQA
SPYLFEATGKRFYFKNVAILIPENWNTKPEYKRPKLETLKNADVLVSTMSPIGNDEPYTE
HIGACGERGIRIHLTPDFLAGKKQTEYGPQDRTFVHEWAHFRWGVFDEYNNNEKFYLSNG
KPQAVRCSATITGKHVVRRCQGGSCVTNGKCVIDRVTGLYKDNCVFIPDKNQREKASIMF
NQNINSVVEFCTEKNHNKEAPNAQNQRCNLRSTWEVIQESEDFKQTTPMTAQPPAPTFSL
LQTRQRIVCLVLDKSGSMQSDNRLNRMNQASRLFLLQTVEQGSWVGMVTFDSTAYVQSEL
TQLNSGADRDLLIKRLPTVASGGTSICSGLQAAFTSIKKKYPTDGAEIVLLTDGEDNTIS
SCFDLVKNSGAIIHTVALGPSAAKELEQLSKMTGGLQTYSSDQIQNNGLVDAFAALSSGN
AAISQHSIQLESRGVNLQNKQWMNGSVIVDSTVGKDTLFLVTWTTNSPSIFIWDPSGVQQ
SGFVLDTNTKVAYLQVPGIAKVGFWKYSIQASSQTLTLTVTSRAASATLPPITVTPVVNK
NTGKFPSPVTVYASIRQGASPILRASVTALIESVNGKTVTLELLDNGAGADATKNDGVYS
RFFTAFDANGRYSIKIWALGGVTADRQRMAPQRNGVMYIDGWIEDDGEIKMNPPHPETGN
VQDSQVCFSRTSSGGSFVATNVPAAPIPDLFPPCQITDLKASIQGQNLVNLTWTAPGDDY
DHGRASSYIIRISTSIVDLRNNFSTSLEVNTTDLIPKEASSEEMFEFELDNSFGNGTDVF
IAIQAVDKSNLKSEISNIARVSLFIPAQEPPEDSTPSYPEVSINSTIPGIHVLNIVWKWL
GEMHVTLGLH
NT seq 2733 nt   +upstreamnt  +downstreamnt
atgggatctttgaagagtcctgtcttcctcttggtcctctaccttctggaaggggttctg
agcaattccctcatccagttgaacaacaatggctatgaaggcatcgtcattgccatagac
cacgatgtgccagaagatgaagccctcatccaacggataaaggacatggtgactcaggcc
tctccatacctgtttgaagctacagggaaaagattttacttcaaaaatgttgccattttg
attcctgagaattggaacacaaaacctgaatataagaggccaaaacttgaaaccttaaaa
aatgctgatgtccttgtgtcaacaatgagccccataggtaatgatgagccctacaccgag
cacataggagcatgtggagaaagggggatcaggattcacctgactcctgacttcttagca
ggaaagaagcagactgagtatggcccacaagacaggacgtttgttcatgagtgggctcac
ttccgatggggggtgtttgacgagtacaacaacaacgagaagttctacttgtccaacgga
aagccccaggcagtaagatgttcggcaaccattaccggtaaacatgtagttcgtcggtgc
cagggaggcagttgcgtcactaacggaaagtgcgtaatcgacagagtaacgggactgtat
aaagataactgtgtattcataccagataaaaaccagagagagaaggcgtccatcatgttt
aaccaaaatatcaactctgtggttgaattctgtacagaaaaaaatcacaataaagaagcc
cccaatgcccaaaaccaacgatgcaacctccgaagcacttgggaagtcatccaggaatct
gaggacttcaagcaaaccactcccatgacagcccagccacccgcacccaccttctcactg
ctgcaaaccagacaaagaatcgtgtgcctcgttcttgataagtccgggagcatgcagagc
gataaccgtcttaaccgaatgaatcaggcaagccggcttttcctgctgcagactgtggag
cagggatcctgggtcgggatggtgaccttcgacagtaccgcctatgtacaaagcgaactc
acacagttaaacagtggtgctgacagagacctgctgatcaagcgcttacccacagtagct
tcaggagggacgtctatatgctctgggcttcaggcagcatttacatcgataaagaagaag
tacccgacggatggagctgaaatcgtgctgctgaccgacggggaagataacaccattagc
agctgctttgacctggtgaagaacagtggggccatcattcacacagtggccctgggaccg
tctgccgctaaagagcttgaacagctgtccaaaatgacaggaggcttgcaaacgtattct
tccgatcagattcagaacaacggtcttgttgatgctttcgcagctctctcctcaggaaat
gcagctatctctcagcactccatccagctggagagcagaggagttaatctccagaataag
cagtggatgaatggctcagtgatcgtggacagcacagtggggaaggacaccttgtttctt
gtcacctggactacgaattctccttcaatatttatctgggatcccagtggagtgcaacaa
agtggttttgtactagacaccaacaccaaggtggcctacctccaagtcccaggcatagcc
aaggttggcttttggaaatacagcattcaagcgagctcacagactctcactttgactgtc
acctcccgggcagcaagcgctacactgcctccaattacagtgaccccagtagtgaataag
aacacagggaaattccccagccctgtaaccgtgtatgcaagcattcgccaaggagcctcg
cctattctcagggccagtgtcacagccctgattgaatctgtgaatggaaaaacagtaacc
ctggaattactggataacggagcaggtgccgatgctaccaagaatgatggtgtctactca
aggttttttacagcttttgatgcaaatggtagatacagcatcaaaatatgggctctggga
ggagttactgcagacagacagagaatggcccctcagaggaatggagtcatgtacatagat
ggctggattgaagacgacggtgaaataaaaatgaatccaccacaccctgaaactggtaat
gttcaagacagccaagtgtgcttcagcaggacatcctcagggggatcgtttgtggccacc
aacgtccccgcagctcccattcctgacctctttccaccttgccaaatcactgacctgaag
gctagcattcaagggcagaaccttgtgaatctgacgtggacggctcctggggatgattac
gaccacgggagagcttccagttacatcatccgaataagcacgagtatcgtcgatctcaga
aacaacttcagcacctcactcgaagtgaacactaccgatctcatccccaaggaggccagc
tccgaggaaatgtttgagtttgaactggacaacagctttggaaatggcacagatgtcttc
attgctatccaggctgtggataagtccaacctgaaatcagaaatctccaacattgcccgg
gtgtctctgttcatccccgctcaggagccgccagaagactcaactccttcttatcccgaa
gtcagcatcaacagcacgattcctggcatccacgtgctgaatatagtgtggaagtggcta
ggggaaatgcatgtgacactaggtttgcactga

KEGG   Rattus norvegicus (rat): 308016
Entry
308016            CDS       T01003                                 

Gene name
Clca2
Definition
(RefSeq) calcium-activated chloride channel regulator 2
  KO
K05028  calcium-activated chloride channel regulator 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04924  Renin secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    308016 (Clca2)
  09154 Digestive system
   04972 Pancreatic secretion
    308016 (Clca2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    308016 (Clca2)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   308016 (Clca2)
SSDB
Motif
Pfam: CLCA VWA_2 VWA
Other DBs
NCBI-GeneID: 308016
NCBI-ProteinID: NP_001100920
RGD: 1304894
Ensembl: ENSRNOG00000013771
UniProt: D3ZVT7
Position
2
AA seq 942 aa
MILGGNTGPVGRLKLVTLLFALSPELVFLGAGLKLKENGYDGLLVAINPRVPEDLKLIRN
IQEMITEASFYLFNATKRRVFFRSVQILIPATWTAHNYSRVKQESFDKANVLVTEQNGVP
GEDPYTLQHRGCGQEGKYIHFTPNFLLNDELAAGYGSRGRVFVHEWAHLRWGVFDEYNSD
KPFYVNGRNEIQVTRCSSDITGVFVCEKGLCPHEDCIISKLFREGCTFLYNSTQSATGSI
MFMQSLPSVVEFCNEGTHNREAPNLQNRVCSLRSTWDVITGSSDLNHSLPVLGVELPAPP
SFSLLQAGDRVVCLVIDVSRKMAEGDRLLRLQQAAELFLMQVVEAHTFVGIVTFDSKGEI
RAPLQQINSDDDRKLLVSYLPTTVSTEAETNICAGVKKGFEVVEKQNGRADGSVMILVTS
GADEHITNCLLTAMSSGSTIHSMALGSSAARRLGELSHVTGGLEFFIPDPFTSSRMTEAF
SGISSGAGDIFQQSLQLESTCETVQPQHQLANTVTVDRAVGNDTFFLVMWQTGGPSEIVL
LDPSGRKYNTGDFIINLPFRTASLKIPGTAKHGHWTYTLNNTHHSPQALKVTVASRASSL
AVSPATVDAFVERDSTYFPQPVIIYANVRKGLYPILNATVMATVEPEAGDPVVLQLLDEG
AGADVIKNDGIYSRYFFSFAVSGRYSLTVHVRHSPSTSTLAHSVPGNHAMYVPGYVTNDN
IQMNAPKRTGRRPVKERWDFSRVSSGGSFSVLGVPDGPHPDVFPPCRITDLAAMNVEEDV
TLSWTAPGEDFDQGQTTSYEIRMSKSLQRIRDDFDNAILVNSSGLIPQHAGTRETFTFSP
KLVTHELEHEPDEEAQETYIVYVALRAMDRSSLRSAVSNIVLVSMSLPPNSAPVVSRDDR
ILKGVLTIVGLITILCLLLVVSHCTLNRKKRASRKENETKFL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatcctcgggggtaacacaggacctgttggcaggctgaaactcgtgactcttctgttt
gccctaagtccagaacttgtgttcctgggagctggattgaagctgaaagagaatggttat
gatggattgcttgttgcgatcaatcctcgggtaccggaggacttgaagctgatcagaaac
attcaggagatgatcaccgaagcttccttttacctgttcaatgcgaccaagagaagggtg
tttttcagaagtgtacagattctaatacctgccacttggacagcgcataattacagcagg
gttaaacaggaatcctttgacaaggcaaatgtcttagtgactgagcagaatggggtaccc
ggggaagacccttataccctacaacacagagggtgtggacaagaggggaaatacatccat
ttcacccccaacttcctactcaacgatgagttagcagcaggatatggctctcgaggccga
gtgtttgtccacgagtgggcccatctccgctggggtgtgtttgatgaatataacagtgac
aagccgttctacgtgaatggacggaatgagattcaagtcaccaggtgttcatctgacatc
acgggtgtttttgtttgtgaaaagggcctttgcccccacgaagactgcatcattagcaag
ctttttagggaaggatgcacattcctctacaacagcacccagagtgcaactggatcaata
atgttcatgcagagtttaccttctgtggttgaattctgtaacgaaggcacccacaatcga
gaagccccaaatctccagaaccgagtgtgcagcctcagaagcacttgggatgtgatcact
ggctcctcagacctgaaccacagcctcccggtgctgggggttgagcttccagcccctccc
tcgttctccctcttgcaggctggtgaccgagtggtctgcttagtgattgatgtgtccagg
aagatggcagagggagacagactcctccggctacaacaagcagccgaactgttcttgatg
caggtcgttgaagctcatacttttgtgggcattgtcacttttgacagcaaaggagaaatc
cgagccccgttgcaacaaattaacagcgacgatgaccggaagttgctggtttcgtacctg
ccgaccactgtgtccactgaagcagagaccaacatctgtgcaggggttaagaaaggcttt
gaggtggttgagaagcagaatggacgagcggatggctctgtcatgatattagtgaccagc
ggagcagatgaacacatcaccaactgcctgctcaccgcaatgagcagtgggtccaccatt
cattccatggccctgggctcctctgcagccagaagactgggggaattatcacatgttaca
ggaggtttggagttcttcattccagatccatttacctctagccgaatgactgaagccttc
agtggaatctcttctggggcaggagacattttccagcaaagcttacagcttgaaagcacg
tgcgagactgtgcaaccccagcaccaactggcaaatactgtgactgtggatagggctgtg
ggcaatgacacgtttttcctagtcatgtggcagaccggtggtccctctgagattgtatta
ttggaccctagtggaagaaaatacaacactggtgactttatcatcaatctgccctttcgg
acagccagccttaagattccaggaactgctaagcatgggcactggacttacacgctgaac
aatacccaccattctcctcaagctctgaaagtgactgtggcctcccgtgcctccagtctg
gccgtgtccccagccaccgtggacgcctttgtggaaagggacagcacctattttcctcag
ccggtgataatttatgcaaacgtgaggaagggtctgtaccccatactcaatgccactgtg
atggcaacggttgagcctgaggctggagaccctgttgtgctgcaacttttggatgaagga
gcaggcgccgatgttataaaaaatgatggaatttactccaggtattttttctcctttgct
gtaagtggtagatatagcttgacagtgcatgtccgtcactctcccagcacaagcacccta
gcccactctgtcccaggaaaccatgctatgtatgtaccaggttacgtaaccaacgataat
attcaaatgaatgctcccaaaagaacaggccgcagacctgtgaaggagcggtgggacttc
agtcgagtaagctctggaggctccttctcagtgctgggagtcccagacggcccccaccct
gacgtgttcccaccatgcagaattacggacctggcagccatgaacgtagaagaggatgtg
accctctcttggacggcacctggggaagacttcgatcaggggcaaaccacaagctatgaa
ataagaatgagcaaaagtctacagcgtattcgggatgactttgacaatgccatcttggtg
aactcgtcggggctaattcctcagcatgctggcaccagggagacatttacattctcaccc
aagcttgtcacccatgaacttgaacatgaacctgatgaagaagcacaagaaacctacata
gtgtatgtggccctgagagccatggatagaagctccctccggtcagctgtgtcaaacatt
gtcctggtatcaatgtctctccccccaaactctgctcctgtagtgagcagagatgacagg
atactgaaaggagttttaacaatagtaggtttgataacgattctttgccttcttctggtt
gtatcacactgtactttaaacaggaaaaagagagcatcaaggaaagagaatgaaacaaaa
tttctatga

KEGG   Rattus norvegicus (rat): 362052
Entry
362052            CDS       T01003                                 

Gene name
Clca5
Definition
(RefSeq) chloride channel accessory 5 precursor
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04924  Renin secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    362052 (Clca5)
  09154 Digestive system
   04972 Pancreatic secretion
    362052 (Clca5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    362052 (Clca5)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   362052 (Clca5)
SSDB
Motif
Pfam: CLCA VWA VWA_2 MG2 VWA_CoxE VWA_3
Other DBs
NCBI-GeneID: 362052
NCBI-ProteinID: NP_001013220
RGD: 621100
Ensembl: ENSRNOG00000013334
UniProt: Q75ZI5
Position
2
AA seq 903 aa
MVPVLKVLLFLTLHLLQDTKSFKVHLNNNGYEGVVIAINPSVPEDERLIPSLKEMVTQAS
TYLFEASQGRFYFRNVSILVPMTWKSKSEYLMPKRESYDKADVIVANSHLKYGDNPYTLQ
YGQCGDRGRYIHFTPNFLLTDNVRNYGPRGRVFVHEWAHLRWGVFDEYNEDRPFYISGKN
TIEVTRCSTDIKGSKAVHERQRGSDVTRLCRWDSRTGLYEPKCKFFPDKIQTARASIMFM
QNLNSVVEFCTEKTHNTEAPNLQNKICNGRSTWDVIKESADFQQAPPMRGTEAPPPPTFS
LLKSRQRVICLVLDKSGSMDTEDRLIRMNQAAELYLTQIVEKESMVGLVTFDSTAQIQNY
LIKITNTGDYKKITGNLPQQAVGGTSICRGLEAGFQAITSSDQSTSGSEIVLLTDGEDDL
ISSCFEVVKHSGAVIHTIALGPKAARELETLSDMTGGLRFYANKDVNSLMDAFSGISSAS
GNLSQQALQLESKAFNIGGGTWINGTVPVDSTIGNDTFFVITWTVQKPEIILRDPKRKKY
TTSDFQDNKLNIRSARLQIPGTAETGTWTYSLFNKGVKPQLLTVTVTTRARSPTTQPLMA
TAHMSQSTAQYPSPMIVYARVSQGFLPVLGANVTAVIESENGSRVTLELWDNGAGADTVK
NDGIYTRYFTDYHGNGRYSLKVRVQARKSKARLSLRQKNKSLYIPGYVENGKIILNPPRP
EVPEEATEAAVEDFSRLTSGESFTVSGAPPDGGHAHVFPPSKVTDLEAEFKGDHIHLTWT
APGKVLDKGRAHRYVIRMSRHPPGLQDFNDATLVNTSGLIPKEAGSEETFKFKPASFKIE
NGTQLYIAILANNEAGLTSEVSNIAQAVNFIPPEHSFSTLSPDISAICLTIWGLTVILND
ILN
NT seq 2712 nt   +upstreamnt  +downstreamnt
atggtgccagtgctgaaggtccttctgttcctcaccctgcacctcttgcaggacacaaaa
agcttcaaggtccatctcaacaacaatggatatgagggtgtggtcattgcaattaacccc
agtgtaccagaggatgaaagactcatcccaagcttaaaggaaatggtcactcaagcctct
acttacctgtttgaagccagccaaggaaggttttacttcaggaatgtaagcatattagtc
ccgatgacctggaagtcaaaatctgagtacttgatgccaaaacgagaatcatatgacaaa
gcagatgtcatagttgccaattctcatctgaaatatggagacaatccctacacccttcaa
tatgggcagtgtggggacagaggacggtacatacatttcactccaaacttcctgctcact
gataacgtgcgtaactatggaccccgaggcagagtctttgtccatgagtgggctcatctc
cggtggggagtgtttgatgagtataatgaggaccggcctttctacatatctggaaagaac
actatcgaagtgacaaggtgttctaccgacatcaagggctctaaggcggtccatgagcgc
cagagaggcagcgatgtgacaaggttatgccgatgggactcgaggacagggctgtatgaa
cccaaatgtaaatttttcccagacaaaattcagactgccagggcctccataatgttcatg
caaaatctcaattccgtggttgaattttgcacagaaaaaacccataatacggaagcccca
aacctacaaaacaaaatatgcaatggcagaagcacgtgggacgtaatcaaggagtccgct
gactttcagcaggcccctcccatgagaggaacagaagcccctcctccacccacgttttcc
ttgctcaagtccagacagcgagtgatctgcttggtgctggataaatccggaagcatggac
acagaagaccgccttattcgaatgaatcaagcagcggaactgtacttaactcaaattgtt
gaaaaggaatctatggttggattagtcacttttgacagcactgcccaaatccaaaattac
ctgataaaaataactaataccggtgactacaagaaaatcactggaaatctccctcagcag
gctgttggggggacttcaatctgcaggggactggaagcaggatttcaggcaattacctcc
agtgaccagagtacttccggttctgagattgtattgctaacagatggggaagatgatcta
ataagttcatgctttgaggtggtcaaacacagcggtgcggtcattcacaccatcgccctg
gggcctaaagctgcccgagaactggagactttgtcggatatgacaggagggcttcgcttt
tatgccaacaaagatgtgaacagcctgatggacgctttcagtgggatttcctctgcaagt
ggcaacctctcccagcaggctctgcagttggagagcaaagccttcaatattggagggggg
acatggataaatggtacagtacctgtggacagtaccattggcaacgacactttctttgtt
attacctggacagtccaaaagccagaaattattcttcgagatccaaaaagaaaaaaatat
acaacctcagatttccaagacaataaactaaacattcgatctgctcgacttcaaatacca
ggcactgcagagacaggaacttggacttacagcctcttcaataagggggtcaaacctcag
ttgctaactgtgacagtgaccactcgagccagaagtcccaccacacagcccctcatggcc
accgctcacatgagtcagagcacagcccagtaccctagtccgatgattgtgtatgcacgg
gtcagccaagggtttttgcctgttctgggagccaatgtcacagccgtcatagaatctgaa
aatggaagtcgagtcaccctggagctctgggacaacggggcaggtgctgacactgtcaaa
aatgatggcatctacacgagatattttacagattatcacggaaatggtagatacagctta
aaagtgcgtgtccaggcaagaaagagcaaagccagactaagtttaagacaaaagaacaag
tctttatatatacctggctatgttgaaaatggtaaaattatactgaatccacccagaccg
gaagtcccagaagaagctacagaagctgcagtggaagacttcagcagactaacctctgga
gagtcgtttactgtgtccggagcgccccctgatggcggccacgctcatgtgttcccaccc
agtaaagttacagacctggaggccgagtttaaaggtgatcatattcaccttacctggacg
gcccctggcaaggttctcgataaaggaagagcgcacagatacgtcatcagaatgagccgg
catcctcctggtctccaagattttaacgacgctactttagtgaatacttccggtctgata
cctaaagaggctggctcagaagaaacgtttaaattcaaaccagcaagttttaaaatagaa
aacggcacccagctctacattgcaattctggccaacaatgaagccggtctcacctctgag
gtctccaacatcgcacaggctgtcaactttattcctccagaacatagtttctctacactc
agccctgatatttctgcaatctgtctgacaatttgggggttaactgtgattcttaacgat
attttaaactag

KEGG   Rattus norvegicus (rat): 362053
Entry
362053            CDS       T01003                                 

Gene name
Clca4
Definition
(RefSeq) calcium-activated chloride channel regulator 4 precursor
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04924  Renin secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    362053 (Clca4)
  09154 Digestive system
   04972 Pancreatic secretion
    362053 (Clca4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    362053 (Clca4)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   362053 (Clca4)
SSDB
Motif
Pfam: CLCA VWA VWA_2 VWA_CoxE DUF1194 Transgly_assoc
Other DBs
NCBI-GeneID: 362053
NCBI-ProteinID: NP_958822
RGD: 1303234
Ensembl: ENSRNOG00000029889
UniProt: Q6VPP3
Position
2
AA seq 923 aa
MMGFSRGIVFLLLLYLLQGSDTSLVKLNENGYEDIIIAIDPAVSEDVTIIDQIKDMVTKA
SAYLFEATEKRFFFKNVSILIPENWTNSDQYRRPKQESYKHADIKVAPPALQGRDEPYTR
QFTKCGKKAEYIHFTPDFVLGRKQKEYGDSGRLLVHEWAHLRWGVFDEYNEDQPFYSASS
KKIEATRCSTGIKGMNKAQVCQGGSCITRNCRRNSTTQLYEKDCQFFPDKVQTEKSSIMF
MQSIDSVTEFCKKENHNREAPTLHNQKCDYRSTWEVISNSEDFKNSTPMEMPPSPPFFSL
LRISERIVCLVLDVSGSMGSYDRLNRMNQAAKFFLQQILESRSWAGMVHFHSSATVKSEL
IQINSDVERNQLLETLPTSASGGTSICSGIRTAFQVFKNKGYQTGGNDILLLSDGEDSTA
KDCLDEVKDSGAVVHFIALGKAFDQSISNMANVTGGKQLFATDEAQNNGLIDAFGALASE
NADVTEKSLQLESKGAVLTNSRWLNDTVVIDSTVGKDTYFLVTWSQQAPAIHLRDPKGTQ
ITNFTIDTASKMAYLTIPGIAEVGVWTYNLEAKVDSEILTITVTSRASRPSVPPIIVNAK
VNTDTNSFPSPMIVYAEVLQGYTPIIGARVTATIESNSGKTEELVLLDNGAGADAFKDDG
VYSRYFTAYSDNGRYSVKVRADGGTNSARRSSRHPSSRAAYIPGWVVDGEIQGNPPRPET
TEDTQPVLENFSRTASGGAFVMSKVPALPLPDQYPPNQITDLQATLDGEKISLTWTAPGD
DFDVGRVQQYIIRTSENIIDLRDNFNKSLQVNTTHLIPKEANSKETFAFKPETISGENAT
YIFIAIESVDKSNLHSGLSNIAQVALFTPQADPVPEESPQSGVSITTIVLSVVGAVVLVC
IIVSTTVCILKRKRSSSGPATTF
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgatggggttctccagagggattgttttcctcctgctcctgtacctgcttcaggggtca
gacacctccttggtaaagctgaatgagaatggttatgaagacattattattgccatcgat
cctgctgtgtccgaagatgtaacaataattgaccaaataaaggacatggtgactaaagca
tctgcatacctttttgaagctacagaaaaaagattttttttcaaaaacgtctctatatta
attcctgagaattggacaaacagtgaccagtacaggaggccaaagcaggaaagctacaaa
catgctgacattaaagttgcacctcctgctctccagggcagggatgagccctacacccgg
cagttcacaaagtgtggaaagaaagctgaatacatccacttcacccccgactttgtattg
gggagaaaacaaaaggaatatggagattcaggaagactgttggtccatgaatgggcccat
cttcgctggggagtatttgatgagtacaacgaagaccagccattctacagtgcttcatca
aagaaaatcgaagcaacaaggtgttccacaggtatcaagggtatgaataaagcccaggta
tgccaagggggcagctgtataaccagaaattgcagacggaattccaccacacagttatat
gaaaaagattgtcagttcttcccggataaagttcaaacagaaaagtcatctataatgttc
atgcaaagtatcgattcagtgactgaattctgtaaaaaagaaaaccataatcgagaggct
ccaactctacataatcagaagtgcgattacagaagcacatgggaagtaatcagtaattct
gaggattttaaaaacagcacacccatggagatgccaccctctccacccttcttctcgctg
ctgaggatcagtgaaagaattgtgtgcctagtgcttgatgtgtctgggagcatggggtct
tatgatcgcctcaatcgaatgaaccaagcagcaaaattcttcctacagcagatacttgaa
agtaggtcctgggcagggatggtacactttcatagctcggccactgttaagagtgagctg
atccaaataaacagtgatgtcgagagaaaccagcttttggaaaccttacctacaagtgct
agcggagggacatccatctgctctggaatcagaactgcatttcaggtatttaaaaataaa
ggataccaaactggtgggaatgacatcttgctgttgagcgatggggaggacagcacagcc
aaagactgccttgatgaggtgaaagacagcggggccgtagttcatttcattgccttggga
aaagcatttgatcaatctatatcaaacatggccaacgtaacaggtggaaagcaactgttt
gctacagatgaagcccagaacaatggactcattgatgctttcggggccctggcttcagaa
aatgctgatgtcactgagaagtcccttcagcttgaaagcaagggtgctgtgttgaccaac
agtcgctggctgaacgacactgtcgttattgacagcaccgtgggaaaggacacatacttt
cttgtcacctggagccaacaagcccctgccattcatctcagggatcccaaaggaacacaa
ataacaaatttcacaatcgacacggcttccaaaatggcctatctcactatcccaggaatt
gctgaggtcggcgtttggacttacaaccttgaagccaaagtagactcagagatactaaca
attacagtaacttctcgggcatcacgtccttctgtgccacccatcattgtaaatgcaaaa
gttaacacagacacgaacagtttccccagtccaatgattgtgtatgcagaagttctacaa
ggttacactcccatcattggagcacgcgtgacagctaccatagaatcaaatagtggaaaa
acagaagagctagtactgctggacaatggtgcaggggctgatgctttcaaggatgacggg
gtctactccaggtacttcacggcttattcagataatggcagatatagcgtaaaggtccgc
gcagacggaggaacaaactctgcccggagaagttcacggcatccgtccagcagagcggca
tacataccaggctgggtagtggatggagaaattcaagggaacccacccagacctgaaact
actgaggacactcagcccgtcctggagaatttcagcaggacggcatctggaggtgccttt
gtgatgtccaaggtcccagctcttccattgcctgatcagtacccaccaaatcaaatcaca
gacctccaggccacacttgatggggaaaagatcagtctaacatggacggcaccaggagat
gactttgatgttggaagagttcaacagtatatcataagaacaagtgaaaatatcattgac
ctcagagacaattttaataagtctcttcaggttaatacaactcacctgataccaaaagaa
gccaactccaaggaaacctttgcctttaaaccagaaactatctcaggagaaaacgcaacc
tacatattcattgccattgaaagtgtcgacaaaagcaatttgcactccggactgtccaac
atcgcacaagtagcactgttcacccctcaggcagatcctgtccctgaggaaagtccccag
tctggagttagtatcactacgattgtgctgtctgtggtgggcgccgttgtactagtttgt
atcattgtaagtaccactgtttgtatcttaaagagaaaaaggtcctcctcagggcctgca
acaacattttaa

KEGG   Rattus norvegicus (rat): 499721
Entry
499721            CDS       T01003                                 

Gene name
Clca4l
Definition
(RefSeq) chloride channel calcium activated 4-like precursor
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04924  Renin secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    499721 (Clca4l)
  09154 Digestive system
   04972 Pancreatic secretion
    499721 (Clca4l)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    499721 (Clca4l)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   499721 (Clca4l)
SSDB
Motif
Pfam: CLCA VWA_2 VWA VWA_3 MG2 VWA_CoxE Peptidase_C39
Other DBs
NCBI-GeneID: 499721
NCBI-ProteinID: NP_001070824
RGD: 1591945
Ensembl: ENSRNOG00000036877
UniProt: Q05KA7
Position
2
AA seq 905 aa
MVPVLKVLLFLTLHLLQDVKSSKVHLNNNGYEGVVIAINPSVPEDERLIPSLKEMVTQAS
TYLFEATRRRFYFRNVSILVPITWKSKTEYLTPKQESYDQADVIVADPHLKYGDDPYTLQ
YGQCGDRGQYIHFTPNFLLIDNLIIYGPRGRVFVHEWAHLRWGVFDEYNKERPFYLSRKN
VVEATRCSTDITGTNVVHECQGGSCVTRKCRRDSKTGLPEPKCTFIPNKSQTARASIMFL
QSLDSVVEFCTEKTHNTEAPNLQNKICNGRSTWDVIKESADFQHAPPMRGTEAPPPPTFS
LLKSRQRVVCLVLDKSGSMSSGDPITRLTLMNQAAELYLIQILEKESLVGLVTFDSIAIV
QNNLIRMINDSSYLEISAKLPQEAAGGTSICNGLRKGFETITSSDQSTCGSEIVLLTDGE
DDQISSCFEEVKHSGAVIHTIALGPDAARELETLSDMTGGRRFYASEGINGLIDAFSGIS
SKSGSLSQQALQLESKALEIKEKEWLSGTVPVDSTVGNDTFFVVTWTVQKPEIILQDPKG
KNYRTSDFQEDKLNIFSVRLQIPGIAETGTWTYSLFNKGVKPQLLTVTVTTRARSPTTQP
LMATAHMSQSAAQYPSPMIVYARVSQGFLPVLGANVTAVIESETGHQVTLVLWDNGAGAD
TLRNDGIYSRYFTEFHGNGRYSLKVSAQARKNITKLNLKQKNKALYIPGYVENDQIILNP
PRPEVPEEATEAAVEDFSRLTSGESFTVSGAPPDGGHAHVFPPSKVTDLEAEFKGDHIHL
TWTAPGKVLDKGRAHRYVIRMSRHPPGLQDFNDATLVNTSGLIPKEAGSEETFKFKPASF
KIENGTQIYIAIQAENEAGLTSEVSNIAQAVNFIPPREPSNPNLGNKMPVPCLTVLVFVA
TLFIF
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggtgccagtgctgaaggtccttctgttcctcaccctgcatctcttgcaggatgtgaaa
agctccaaggtccatctcaacaacaatggatacgagggtgtggtcattgcaattaacccc
agtgtaccagaggatgaaagactcatcccaagcttaaaggaaatggtaactcaagcctcc
acttacctgtttgaagccaccaggagaagattttacttcaggaacgtgagcattctagtt
cccataacctggaagtcaaaaactgagtacttaacaccgaaacaagaatcatatgaccaa
gcagacgtcatagttgccgatcctcatctgaaatatggagacgatccctacacccttcaa
tatgggcagtgtggggacagaggacagtacatacatttcactccaaacttcctgctcatt
gataacttgattatctatggaccccgaggcagagtctttgtccatgagtgggcccatctc
cggtggggagtatttgatgagtacaacaaagaacgtcccttctacctatcgagaaagaat
gttgttgaagcaacaaggtgttctactgacatcactggcaccaatgtggtccatgagtgt
cagggaggcagttgcgtgacaagaaagtgccggcgagattcaaagacaggactaccggaa
cccaagtgtacatttatcccaaacaaatcccagacagccagggcctccataatgttcctg
caaagtctggattctgtggttgaattttgcacagaaaaaacccacaatacggaagcccca
aacctacaaaacaaaatatgcaatggcagaagcacgtgggacgtaatcaaggagtccgct
gactttcagcatgcccctcccatgagaggaacagaagcccctcctccacccacgttttcc
ttgctcaagtccagacagcgagtggtctgcttggtgctcgataaatccggaagcatgagc
tcaggagaccccatcactcgtctcaccctaatgaaccaagcagcagagctgtacttaatt
caaatccttgagaaggaatccttggtcggcctggtcacgtttgatagcattgctatagtc
caaaataacctcataagaatgatcaacgacagctcctacctagagatcagtgcaaagctt
ccccaagaagctgctggcggaacttcaatttgcaacggactcagaaaaggatttgagaca
attacctccagtgaccagagtacttgcggttctgagattgtattgctaacagatggggaa
gatgatcaaataagttcatgctttgaggaggtcaaacacagcggtgccgtcattcacacc
attgccctggggcctgacgctgcccgagaactggagactctgtcggacatgacaggaggg
cgtcgcttttatgccagtgaaggcatcaacggcctgatcgacgctttcagtgggatttca
tccaaaagtggcagcctgtcccagcaggctctgcagttggagagcaaagccctggagatt
aaggagaaggaatggctaagtggcacagttcccgtggacagtaccgtcggcaacgacacg
ttctttgttgtcacctggacagtacaaaagccagaaattatccttcaagatccgaaaggg
aaaaactacaggacctcggatttccaggaagataagctaaatatcttctctgttcgcctt
cagatcccaggcatcgccgagacaggaacttggacttacagcctcttcaataagggggtc
aaacctcagttgctaactgtgacagtgaccactcgagccagaagtcccaccacgcagccc
ctcatggccaccgctcacatgagtcagagcgcagcccagtaccctagcccgatgattgtg
tatgcacgggtcagccaagggtttttgcctgttctgggagccaatgtcacagctgtcata
gaatctgaaactggacatcaagtcaccctggtgctctgggacaacggggcaggtgcggat
acactcagaaatgatggcatctactcaagatatttcacggagtttcatggaaacggcaga
tacagcttaaaagtcagtgcccaggcaagaaaaaacatcacgaaactaaatctgaaacaa
aagaataaggctctttatatacctggctacgttgaaaatgatcaaattatactgaatcca
cccagaccggaagtcccagaagaagctacagaagctgcagtggaagacttcagcagacta
acctctggagagtcgtttactgtgtccggagcgccccctgatggcggccacgctcatgtg
ttcccacccagtaaagttacagacctggaggccgagtttaaaggtgatcatattcacctt
acctggacggcccctggcaaggttcttgataaaggaagagcgcacagatacgtcatcaga
atgagccggcatcctcctggtctccaagattttaacgacgctactttagtgaatacttcc
ggtctgatacctaaagaggctggctcagaagaaacgtttaaattcaaaccagcaagtttt
aaaatagaaaacggcacccagatctacattgcaattcaggccgaaaatgaagccggtctc
acctctgaggtctccaacatcgcacaggctgtcaactttattcctccacgggaacccagc
aaccctaatctgggtaacaaaatgcctgtaccctgtttgacagttttggtatttgttgca
actttattcatattttaa

DBGET integrated database retrieval system