KEGG   Rattus norvegicus (rat): 308016
Entry
308016            CDS       T01003                                 

Gene name
Clca2
Definition
(RefSeq) calcium-activated chloride channel regulator 2
  KO
K05028  calcium-activated chloride channel regulator 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04924  Renin secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    308016 (Clca2)
  09154 Digestive system
   04972 Pancreatic secretion
    308016 (Clca2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    308016 (Clca2)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   308016 (Clca2)
SSDB
Motif
Pfam: CLCA VWA_2 VWA
Other DBs
NCBI-GeneID: 308016
NCBI-ProteinID: NP_001100920
RGD: 1304894
Ensembl: ENSRNOG00000013771
UniProt: D3ZVT7
Position
2
AA seq 942 aa
MILGGNTGPVGRLKLVTLLFALSPELVFLGAGLKLKENGYDGLLVAINPRVPEDLKLIRN
IQEMITEASFYLFNATKRRVFFRSVQILIPATWTAHNYSRVKQESFDKANVLVTEQNGVP
GEDPYTLQHRGCGQEGKYIHFTPNFLLNDELAAGYGSRGRVFVHEWAHLRWGVFDEYNSD
KPFYVNGRNEIQVTRCSSDITGVFVCEKGLCPHEDCIISKLFREGCTFLYNSTQSATGSI
MFMQSLPSVVEFCNEGTHNREAPNLQNRVCSLRSTWDVITGSSDLNHSLPVLGVELPAPP
SFSLLQAGDRVVCLVIDVSRKMAEGDRLLRLQQAAELFLMQVVEAHTFVGIVTFDSKGEI
RAPLQQINSDDDRKLLVSYLPTTVSTEAETNICAGVKKGFEVVEKQNGRADGSVMILVTS
GADEHITNCLLTAMSSGSTIHSMALGSSAARRLGELSHVTGGLEFFIPDPFTSSRMTEAF
SGISSGAGDIFQQSLQLESTCETVQPQHQLANTVTVDRAVGNDTFFLVMWQTGGPSEIVL
LDPSGRKYNTGDFIINLPFRTASLKIPGTAKHGHWTYTLNNTHHSPQALKVTVASRASSL
AVSPATVDAFVERDSTYFPQPVIIYANVRKGLYPILNATVMATVEPEAGDPVVLQLLDEG
AGADVIKNDGIYSRYFFSFAVSGRYSLTVHVRHSPSTSTLAHSVPGNHAMYVPGYVTNDN
IQMNAPKRTGRRPVKERWDFSRVSSGGSFSVLGVPDGPHPDVFPPCRITDLAAMNVEEDV
TLSWTAPGEDFDQGQTTSYEIRMSKSLQRIRDDFDNAILVNSSGLIPQHAGTRETFTFSP
KLVTHELEHEPDEEAQETYIVYVALRAMDRSSLRSAVSNIVLVSMSLPPNSAPVVSRDDR
ILKGVLTIVGLITILCLLLVVSHCTLNRKKRASRKENETKFL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatcctcgggggtaacacaggacctgttggcaggctgaaactcgtgactcttctgttt
gccctaagtccagaacttgtgttcctgggagctggattgaagctgaaagagaatggttat
gatggattgcttgttgcgatcaatcctcgggtaccggaggacttgaagctgatcagaaac
attcaggagatgatcaccgaagcttccttttacctgttcaatgcgaccaagagaagggtg
tttttcagaagtgtacagattctaatacctgccacttggacagcgcataattacagcagg
gttaaacaggaatcctttgacaaggcaaatgtcttagtgactgagcagaatggggtaccc
ggggaagacccttataccctacaacacagagggtgtggacaagaggggaaatacatccat
ttcacccccaacttcctactcaacgatgagttagcagcaggatatggctctcgaggccga
gtgtttgtccacgagtgggcccatctccgctggggtgtgtttgatgaatataacagtgac
aagccgttctacgtgaatggacggaatgagattcaagtcaccaggtgttcatctgacatc
acgggtgtttttgtttgtgaaaagggcctttgcccccacgaagactgcatcattagcaag
ctttttagggaaggatgcacattcctctacaacagcacccagagtgcaactggatcaata
atgttcatgcagagtttaccttctgtggttgaattctgtaacgaaggcacccacaatcga
gaagccccaaatctccagaaccgagtgtgcagcctcagaagcacttgggatgtgatcact
ggctcctcagacctgaaccacagcctcccggtgctgggggttgagcttccagcccctccc
tcgttctccctcttgcaggctggtgaccgagtggtctgcttagtgattgatgtgtccagg
aagatggcagagggagacagactcctccggctacaacaagcagccgaactgttcttgatg
caggtcgttgaagctcatacttttgtgggcattgtcacttttgacagcaaaggagaaatc
cgagccccgttgcaacaaattaacagcgacgatgaccggaagttgctggtttcgtacctg
ccgaccactgtgtccactgaagcagagaccaacatctgtgcaggggttaagaaaggcttt
gaggtggttgagaagcagaatggacgagcggatggctctgtcatgatattagtgaccagc
ggagcagatgaacacatcaccaactgcctgctcaccgcaatgagcagtgggtccaccatt
cattccatggccctgggctcctctgcagccagaagactgggggaattatcacatgttaca
ggaggtttggagttcttcattccagatccatttacctctagccgaatgactgaagccttc
agtggaatctcttctggggcaggagacattttccagcaaagcttacagcttgaaagcacg
tgcgagactgtgcaaccccagcaccaactggcaaatactgtgactgtggatagggctgtg
ggcaatgacacgtttttcctagtcatgtggcagaccggtggtccctctgagattgtatta
ttggaccctagtggaagaaaatacaacactggtgactttatcatcaatctgccctttcgg
acagccagccttaagattccaggaactgctaagcatgggcactggacttacacgctgaac
aatacccaccattctcctcaagctctgaaagtgactgtggcctcccgtgcctccagtctg
gccgtgtccccagccaccgtggacgcctttgtggaaagggacagcacctattttcctcag
ccggtgataatttatgcaaacgtgaggaagggtctgtaccccatactcaatgccactgtg
atggcaacggttgagcctgaggctggagaccctgttgtgctgcaacttttggatgaagga
gcaggcgccgatgttataaaaaatgatggaatttactccaggtattttttctcctttgct
gtaagtggtagatatagcttgacagtgcatgtccgtcactctcccagcacaagcacccta
gcccactctgtcccaggaaaccatgctatgtatgtaccaggttacgtaaccaacgataat
attcaaatgaatgctcccaaaagaacaggccgcagacctgtgaaggagcggtgggacttc
agtcgagtaagctctggaggctccttctcagtgctgggagtcccagacggcccccaccct
gacgtgttcccaccatgcagaattacggacctggcagccatgaacgtagaagaggatgtg
accctctcttggacggcacctggggaagacttcgatcaggggcaaaccacaagctatgaa
ataagaatgagcaaaagtctacagcgtattcgggatgactttgacaatgccatcttggtg
aactcgtcggggctaattcctcagcatgctggcaccagggagacatttacattctcaccc
aagcttgtcacccatgaacttgaacatgaacctgatgaagaagcacaagaaacctacata
gtgtatgtggccctgagagccatggatagaagctccctccggtcagctgtgtcaaacatt
gtcctggtatcaatgtctctccccccaaactctgctcctgtagtgagcagagatgacagg
atactgaaaggagttttaacaatagtaggtttgataacgattctttgccttcttctggtt
gtatcacactgtactttaaacaggaaaaagagagcatcaaggaaagagaatgaaacaaaa
tttctatga

DBGET integrated database retrieval system