KEGG   Rattus norvegicus (rat): 308060
Entry
308060            CDS       T01003                                 

Gene name
Ccdc127, RGD735106
Definition
(RefSeq) coiled-coil domain containing 127
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: FAP206
Other DBs
NCBI-GeneID: 308060
NCBI-ProteinID: NP_942061
RGD: 735106
UniProt: Q6PEB9 G3V7Q3
Position
1p11
AA seq 252 aa
MNNLNDPPNWNIQPNPRADGGDGSKWNYALLVPMLGLAAFRWIWSRESQKEIEKARRAYH
QQTAAFQQDLDAKYHAVISEHRRAVAQLSLELEKEQNRTTSFREALISQGRKLAEEKKLL
EQERAQIIQEKSQRQPLRRAYLSCLEEEDEWQRRAQLVLKEVGEALEERQNIYCSLILPR
SARQQLEKSLLVRTSADPVAADLEMATGLSDIFKHDKHCGDVWNTNKRQNGKLMWMYLKY
WELLVELKKFKK
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaataacttaaacgaccccccaaattggaatatccagcccaatcccagggctgatggg
ggtgacggaagcaagtggaattatgctctgttggtgccaatgctcggattggcagcgttt
cgttggatttggtctagggaatcccaaaaagaaatagaaaaagcaagaagagcatatcat
cagcaaacagctgctttccagcaggatcttgacgctaaataccacgctgtgatctcggaa
caccggcgcgctgttgctcagctctctttggaactggaaaaagagcaaaacagaacaacc
agctttcgagaagcccttatctctcaggggcgtaagttggcagaagaaaagaagcttctt
gaacaggaacgggctcagatcatacaagaaaaaagccagcgtcagcctctgagacgtgcc
tatttgagctgcctggaagaagaggatgagtggcagaggagagcccagcttgtgctgaag
gaggtgggagaagctctcgaggaacgccaaaatatctactgtagcctgattcttccccgt
agtgcacggcaacagctagagaagagcttactggtgcgcacatctgctgatccagtggct
gccgacctagaaatggcaactggcttatctgacatatttaagcatgataagcattgtgga
gatgtctggaacaccaacaaacgccaaaatgggaagctcatgtggatgtatcttaaatat
tgggaactacttgttgaacttaaaaaatttaaaaaatag

DBGET integrated database retrieval system