KEGG   Rattus norvegicus (rat): 308061
Entry
308061            CDS       T01003                                 

Gene name
Pdcd6
Definition
(RefSeq) programmed cell death protein 6
  KO
K23902  programmed cell death protein 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    308061 (Pdcd6)
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    308061 (Pdcd6)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   308061 (Pdcd6)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   308061 (Pdcd6)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 XS WWE PgpA
Other DBs
NCBI-GeneID: 308061
NCBI-ProteinID: NP_001100922
RGD: 1311239
Ensembl: ENSRNOG00000014485
UniProt: G3V7W1
Position
1
AA seq 191 aa
MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPF
NPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKHELKQALS
GFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSY
EQYLSMVFSIV
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctgcctactcctaccgcccaggcccaggtgctggccctggccctgctgctggagct
gcactgccagaccagagcttcctgtggaacgtcttccagcgggttgataaagacaggagc
ggagtgatttcagacaatgaacttcagcaagcattatccaatggtacatggactccgttt
aatccagtgactgtgaggtcaatcatttctatgtttgaccgagaaaacaaggctggtgtg
aacttcagtgaattcacaggtgtgtggaagtatatcacagactggcagaatgtcttccgg
acctacgacagggacaactctgggatgattgacaagcatgagctcaaacaagcactctca
ggttttggctaccggctctctgatcagttccatgacatcctcatccgaaaatttgacagg
caaggacgagggcagatcgcgttcgatgacttcatccagggctgcatcgtcttgcagagg
ttgacagacatattcagacgctatgacacggatcaggatggctggattcaggtgtcttac
gagcagtatctctccatggttttcagcattgtataa

DBGET integrated database retrieval system