KEGG   Rattus norvegicus (rat): 308064Help
Entry
308064            CDS       T01003                                 

Gene name
Cep72, RGD1566336
Definition
(RefSeq) centrosomal protein 72
  KO
K16532  centrosomal protein CEP72
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    308064 (Cep72)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     308064 (Cep72)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_9 LRR_8 LRR_4 GOLGA2L5 FAM76 Spc7 Sec34 Barttin MCPsignal DUF1664 YabA Dynactin_p22 DNA_repr_REX1B ApoLp-III DUF641 HIP1_clath_bdg Fib_alpha
Motif
Other DBs
NCBI-GeneID: 308064
NCBI-ProteinID: XP_001056326
RGD: 1566336
Ensembl: ENSRNOG00000015465
UniProt: D3ZVQ1
Position
1p11
AA seq 646 aa AA seqDB search
MAPGQRLVLCEETVRERSGLGPHRDLAELRSLSIPGTYQEKITHLGNSLMHLTALKSLDL
SRNSLVSLEGIQYLVSLESLNLYYNCISSLAEVFRLHTLMELQDVDFRLNPVVKNESDYR
LFVVHMLPKLRQLDDRPVRESERKASQLHFAPEDSLDSKENFSATLTVGRPHHLRNRCTE
TSAKKCLVMDADDEAVLNLIAECEWDLSNPPGNMSSSQKEHDADLHYAQESRHLLSPLSI
QHQCGDSARRGHEKKKVTSRGCPGHSPQDQLCGELPPQHGLPEACHLHVQHARIASQPDS
VDVEDCASSSQKSTLPSQKIVNPLPVPEKYRKRRMPGGRFQVPSDRECLSFLERADVPSS
LEDSLSRQDGLEGQSQVALSHSEALEAEERTSHGTSDPRVLSPKLCSAAAPERRSTLEMA
LLEALLDLIDRCSSGSGSLHGNEAFLAQARQVLSSLQEFTAARDGSALEKEGVGYLSLEN
KALQSRLTEQHQQYAAAVTKVTTELNNTKRELDTLRQHLDNSLEENDNLKSLLYNVKQEV
KHADTSGALSLQITGLQTSMKQLSGEVMELKQHVAHYDKIQELTQMLQESHSSLVSTNEH
LLQELSRARAQHRAEVEQMHWSFQELKKTTALAPHRSSRLGGRQSC
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaggtcagcggttggttttgtgcgaagagactgtccgggagcgcagcggcctg
ggtccccaccgcgacctggctgagcttcgatctttatcgattcccggaacataccaagag
aagattacacacctggggaactctctgatgcatttgacagctctaaaatccttagacctc
tcacgtaactccttggttagtcttgagggcatacagtatctcgtctctttggagagtctc
aacctctactacaactgtatttcttcactagcagaagtgtttaggctccacaccctcatg
gagctccaggatgtggactttcggcttaaccctgttgtgaagaatgagtctgactaccgc
ctgtttgtcgtgcacatgctcccgaagctccggcagctagatgaccgtcctgtgagagag
agtgagcggaaggcttcccagcttcattttgccccagaggattcactggactcaaaggag
aacttctcagccactttgacagttggaagaccacaccacctcagaaacagatgtactgag
acctcagccaaaaagtgcttggtcatggatgctgacgatgaggctgtcctgaaccttatt
gccgagtgtgaatgggacctaagcaatcctcctgggaacatgagctccagccagaaggaa
catgacgctgacctccattatgcccaggagtccagacatctgttgagtcctttgtccatc
cagcaccaatgtggggactcagcgaggcgaggccatgagaagaagaaagtcacctccaga
gggtgtccaggtcattccccacaggaccagctctgtggggagctccccccacagcatggc
ctgccagaggcctgccatctgcatgtgcagcatgcccgcatcgcttcacagccagactct
gtggatgttgaagactgtgcttcatcttctcagaagtcaactttgccatcacaaaagata
gtaaatcctttgcctgtccctgaaaagtacaggaagcgaaggatgcctggggggagattc
caggtgccttcagaccgggagtgtttgagcttcctagagagggctgacgtgccctccagc
cttgaggacagtctaagcagacaggatggcttggagggccagagtcaggtggccttgtct
cactctgaggctttggaggctgaagagcggacatctcatggcacaagtgaccccagagtg
ctgtctcctaaactctgctcggcagcggcgcctgagcgaaggtccactctggaaatggca
cttctggaggcgctcctcgacctgatagacaggtgctcgagtggcagtggatccctgcat
ggcaatgaggctttcctcgctcaggccaggcaagttttgtcatctcttcaagagttcacc
gcagcgcgggacggttcagcacttgagaaggaaggagttgggtacctgtctctggagaac
aaggctctgcaaagccgccttacggagcagcatcagcagtatgctgctgcggtgaccaag
gtgacgacagagctcaacaacacaaagagggagctggacacattgagacaacatttggac
aactcattggaagagaatgacaacttgaaatctcttctgtacaatgtgaaacaggaagtg
aagcacgcagacacgtcaggtgcactgagtctgcagatcaccggacttcagacaagtatg
aagcagctctctggggaagttatggagctgaagcaacacgtggcgcactatgacaagatc
caggagctcacacagatgcttcaagagagccacagctctctggtcagcaccaatgagcat
ctcctgcaggagctgagccgtgcacgggcacagcacagagctgaggtcgagcagatgcac
tggagcttccaggagctcaagaagactacggccctggccccacaccgtagctcccgcctt
ggtggccggcagtcctgctag

DBGET integrated database retrieval system