KEGG   Rattus norvegicus (rat): 308106Help
Entry
308106            CDS       T01003                                 

Gene name
Map3k4
Definition
(RefSeq) mitogen activated protein kinase kinase kinase 4
  KO
K04428  mitogen-activated protein kinase kinase kinase 4 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    308106 (Map3k4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    308106 (Map3k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    308106 (Map3k4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     308106 (Map3k4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE11 family
   308106 (Map3k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1
Motif
Other DBs
NCBI-GeneID: 308106
NCBI-ProteinID: NP_001100926
RGD: 1311192
Ensembl: ENSRNOG00000017419
UniProt: D3ZGU6
Position
1q11
AA seq 1387 aa AA seqDB search
MNTPSQSPHKDLGKGVEAVEEYSYKQGKKTRATLRTTERDHKKNAQCSFMLDSVAGSLPK
KSIPDVDLNKPYLSLGCSNAKLPVSMPMPIARTARQTSRTDCPADRLKFFETLRLLLKLT
SVSKKKDREQRGQENTAAFWFNRSNELIWLELQAWHAGRTINDQDLFLYTARQAIPDIIN
EILTFKVNYGSAAFSRNGAGFNGTSLEGQCRTLHGTNSLGCSTYHEHLQRQRVSFEQVKR
IMELLEYMEALYPSLQALQKDYERYAAKDFEDRVQALCLWLNITKDLNQKLRIMGTVLGI
KNLSDIGWPVFEIPSPRPSKGYEPEEEGEDTEGELRELESGTEESDEERSPNPRVPELRL
SADTILDSHSQGCASRKLERLESEEDSVGWGIADCGPEASRHCLTSIYRPFVDKALKQMG
LRKLILRLHKLMNGSLQRARVALVKDDRPVEFSDFPGPMWGSDYVQLSGTPPSSEQKCSA
VSWEELRAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQVYFDYMRS
WIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLD
SGLQESCAELWISADDNGAADELRRSVIEISRALKELFHEARERASKALGFAKMLRKDLE
IAAEFVLSASARELLDVLRAKQYVKVQIPGLENLHVFVPDSLAEEKKIILQLLNAATGKD
CSKDPDDVFVDAFLLLTKHGDRARDSEDGWSTWEARAIKIVPQVETVDTLRSMQVDNLLL
VVMESAHLVLQRKAFQQSIEGLMTVHHEQTSSQPVIAKALQQLKNDALELCNRISDAIDR
VDHMFTLELDAEVEESESATLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYI
SFAQKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIG
HVIGKPHSPVTAIHRNSPRPVKVPRCHSDPPNPHLIIPTPEGFRGSSVPENDRLASIAAE
LQFRSLSRHSSPTEERDEPAYPRSDSSGSTRRSWELRTLISQTKDSASKQGPIEAIQKSV
RLFEERRYREMRRKNIIGQVCDTPKSYDNIMHVGLRKVTFKWQRGNKIGEGQYGKVYTCI
SVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEY
CDEGTLEEVSRLGLQEHVIRLYSKQITVAINVLHEHGIVHRDIKGANIFLTSSGLIKLGD
FGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTG
KRPWHEFEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKIRWTASQLLDHAFV
KVCTDEE
NT seq 4164 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaccgagtcagtctccacataaagacttggggaagggagtggaggccgtggag
gagtacagctacaagcaggggaagaagacgcgagcgactctgaggacaacagagcgagac
cataagaaaaatgcacagtgctcgttcatgttggactcagtggccgggtctttgccaaaa
aaatctattccagatgtggatctcaataagccttacctcagcctcggctgtagcaacgcc
aagctgccagtctctatgcccatgcctatagccagaactgcgcggcagacttcccggacg
gactgcccagcggatcggttaaagttctttgaaacactgcgccttttgctaaagcttacc
tcagtctcgaagaagaaggacagggaacagaggggacaggaaaacacggctgctttctgg
ttcaaccggtcaaatgaactgatctggttagagctccaggcctggcacgcaggccgcacc
atcaatgaccaggacctctttttatacacagcccgccaagccatcccagatattatcaat
gaaatcctcacattcaaagttaattatggaagcgctgccttctctagaaatggagctggt
ttcaacggtacctcgctagaaggtcagtgcagaacccttcatgggacgaacagtctaggc
tgttcaacctaccacgagcacctccagcgccagagggtctcatttgagcaggtgaaacgg
ataatggagctgctagagtacatggaagcactttatccgtccttgcaggctctgcagaag
gactacgagagatacgccgcaaaggactttgaggacagagtgcaggcactctgcctgtgg
ctaaacatcacgaaagatttaaatcagaagttgaggattatgggcactgttctgggcatc
aagaacttatcagacattggctggccagtgtttgaaatcccttcccctcggccatccaaa
ggctacgagcctgaggaggagggcgaggacacagagggagagctgagggagctggagagt
gggacggaggagagtgatgaggagcgaagtcccaatccgagggtgccagagctcaggctg
tctgccgacaccatcttggacagtcactcccagggctgcgcgtccaggaaacttgagagg
ctcgagtccgaggaggactctgtaggctgggggatagcagactgtggtcccgaagccagt
aggcattgtttgacttctatctatagaccgttcgtggacaaagcactgaagcaaatgggg
ctgaggaagttaattttacgacttcataagctaatgaatggctccttgcaaagggctcgt
gtagctctggtaaaggatgaccgtcctgtggagttctctgactttccaggtcccatgtgg
ggctcggattatgtgcagttgtcggggacgcctccttcctcggagcagaagtgcagtgct
gtgtcctgggaagagctgagggccatggacctgccctcctttgagcccgccttcctggtg
ctctgccgggtcctgctgaacgtgatccatgagtgcctgaagctgcggctggaacagagg
ccggccggggagccttccctcttgagtatcaagcaggtgtattttgactacatgagaagc
tggatccaaatgctacagcagttacctcaggcttcccatagcttaaaaaacctgctagaa
gaagaatggaatttcaccaaagaaataacccattacatccggggaggagaagcacaggct
ggaaagcttttctgtgacattgcagggatgctgctgaaatccacggggagctttctggac
tctggcctacaggagagctgtgctgaactgtggatcagcgccgacgacaacggtgctgcc
gacgagctaaggaggtctgtcatcgagatcagccgagcactcaaggagctcttccatgag
gcccgggaaagagcctccaaggccctgggctttgctaaaatgctgaggaaggacctagaa
atagcagcagagtttgttctgtctgcgtctgcccgagagctcctagacgttctgagagca
aagcagtatgttaaggtacagattcctgggctagagaatttgcacgtgtttgtccccgac
agcctcgctgaggagaagaaaattattttgcagctactcaatgctgccacaggaaaggac
tgctcaaaggatccggacgacgtctttgtggatgccttcctgctcctgaccaagcatggg
gaccgagcccgtgactcagaagatggctggagcacatgggaagcacgagctatcaaaatt
gtgcctcaggtggagaccgtggacaccctgagaagcatgcaggtggacaaccttctgctg
gttgtcatggagtctgctcacctcgtacttcagagaaaggccttccagcagtccattgag
gggctgatgactgtacaccatgagcagacatccagccagccagtcattgccaaagcttta
cagcagctaaagaacgatgcgctcgagctgtgcaacagaataagcgatgccatcgaccgc
gtggaccacatgttcacgctggagttggatgccgaggtcgaggagtccgagtcggccacg
ctgcagcagtactaccgagaggccatgattcagggctacaacttcgggtttgagtatcat
aaagaagttgttcgtttgatgtctggagaattcagacagaagataggagacaaatatata
agctttgcccagaagtggatgaattatgtgctgaccaaatgtgagagcggcagaggcaca
agacccagatgggccacccaaggttttgatttcctacaagccattgaacctgcctttatt
tcagctttaccagaagatgacttcttgagtttgcaagccctgatgaatgagtgcattggg
cacgtcataggaaagccacacagccctgtcacagctatccatcggaacagcccccgccct
gtgaaggtgccccgatgccacagtgaccctcctaaccctcacctcatcatcccaactcca
gagggattcaggggttccagcgtccctgaaaatgaccgcttggcctccatagctgcagaa
ctgcagttcaggtctctgagtcggcactcgagccccacggaagagcgagacgagccagca
tatcctcggagcgactcaagtggatcaacacggagaagctgggaacttcgaacactcatc
agccagaccaaagactcggcctctaagcaggggcccatagaggccatccagaagtcagtc
cgactgtttgaagagaggaggtatcgagagatgaggaggaagaatatcatcggtcaagtg
tgcgatacccctaagtcctatgataacatcatgcatgttggactgaggaaggtgacgttt
aagtggcaaagaggaaacaaaatcggagaagggcagtatggaaaagtgtacacctgcatc
agcgtcgacacaggggagctgatggccatgaaggagattcgatttcagcctaacgaccat
aagactatcaaggaaactgcagacgagttgaaaatatttgaaggcatcaagcaccccaac
ctggtccggtactttggtgtggagcttcacagggaagagatgtacatcttcatggagtac
tgtgatgaaggcacactagaggaggtgtcaaggctgggccttcaggagcacgtcatccgg
ttgtattccaagcagatcactgtcgccatcaacgtcctccatgagcatggcatcgttcac
cgagacatcaaaggtgccaatatcttccttacatcgtctggactaatcaaactgggagat
tttggatgctcagtgaaacttaaaaacaatgctcagaccatgcctggcgaggtgaacagc
accctagggacagcagcttacatggcccctgaagttattacccgagctaaaggagaaggc
cacggacgtgcggcagacatctggagtctggggtgcgtcgtcatagagatggtgactggc
aagcggccttggcatgagtttgaacacaactttcagattatgtacaaggtgggaatggga
cacaagccaccaatccccgaaaggttaagccctgaaggaaaggactttctctcgcactgc
ctggaaagtgacccgaagataaggtggacagccagccagctccttgaccacgcttttgtc
aaggtttgcacagatgaagagtga

DBGET integrated database retrieval system