KEGG   Rattus norvegicus (rat): 308163Help
Entry
308163            CDS       T01003                                 

Gene name
Ccr6
Definition
(RefSeq) C-C motif chemokine receptor 6
  KO
K04181  C-C chemokine receptor type 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    308163 (Ccr6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    308163 (Ccr6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    308163 (Ccr6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    308163 (Ccr6)
   04050 Cytokine receptors [BR:rno04050]
    308163 (Ccr6)
   04090 CD molecules [BR:rno04090]
    308163 (Ccr6)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    308163 (Ccr6)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   308163 (Ccr6)
CD molecules [BR:rno04090]
 Proteins
  308163 (Ccr6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 308163
NCBI-ProteinID: NP_001013163
RGD: 1308562
Ensembl: ENSRNOG00000012964
UniProt: Q5BK58
Position
1q12
AA seq 366 aa AA seqDB search
MNFTEANYGMEDYTGSDYSMFPETEPCSLQEVRDFTKVFVPIAYSLICVFGLLGNIMVVI
TFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATDTWIFGNTMCKLMKGTYAVNF
NCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICLTVWFVSIIISSPTFFFNKQY
KLQGRDVCEPQYKLVSEPITWKLLGMGLELLFGFFIPLLFMVFCYLFIIKTLVQAQNSKR
HRAIRVVIAVVLVFLACQIPHNMVLLVTAANTGKMGRSCSAEKALAYARNVAEVLAFLHC
CLNPVLYAFIGQKFRSYFMKIMKDVWCMRRKSKVPTFFCARVYSESYISRQTSETVENDN
ASSFTM
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaccgaggccaactacggaatggaagattatactggctcagattactctatg
tttccagagaccgagccatgctctctgcaagaggtcagagacttcaccaaggtgttcgtg
ccaatcgcctactccttaatctgtgtctttggcctccttggcaatattatggtggtgata
acctttgccttctacaagaaagccaggtccatgactgacgtctacctattgaacatggcc
atcacagacatactctttgtcctcaccctaccattctgggcagttactcatgccactgac
acttggatctttggcaacacgatgtgtaaactgatgaaaggcacgtatgcggtcaacttt
aactgtgggatgctgctcctggcctgtatcagcatggaccggtacattgccatcgtccag
gcgaccaaatctttccgggtacgctccagaacactgacgcacagtaaggtcatctgtctg
acggtgtggttcgtttccatcatcatctcaagccccacattcttcttcaacaagcaatac
aagctgcagggccgtgatgtctgcgagcctcagtacaagctcgtctcggagcccatcacg
tggaaactgctgggcatgggactcgagctgctctttggcttcttcatccctttgctgttt
atggtgttctgttacctgttcatcatcaagaccttggtgcaggcccagaattccaagagg
cacagagccatccgagtcgtgattgctgtggttctcgtgttcctggcttgtcagatccct
cacaacatggtcctcctcgtgactgcagccaacacgggcaaaatgggccgcagctgcagc
gccgagaaagccctcgcctacgccaggaatgtggctgaggtcctggctttcctgcactgc
tgtctcaaccccgtgttgtatgccttcattggacagaaattcagaagctacttcatgaag
atcatgaaggatgtgtggtgtatgaggaggaagagcaaggtgcctaccttcttctgtgcc
cgggtttactcagaaagctacatctccaggcagaccagtgagactgtagaaaatgacaac
gcatcgtcctttaccatgtaa

DBGET integrated database retrieval system