KEGG   Rattus norvegicus (rat): 308282Help
Entry
308282            CDS       T01003                                 

Gene name
Shprh
Definition
(RefSeq) SNF2 histone linker PHD RING helicase
  KO
K15710  E3 ubiquitin-protein ligase SHPRH [EC:3.6.4.- 2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    308282 (Shprh)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     308282 (Shprh)
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     308282 (Shprh)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    308282 (Shprh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Linker_histone Helicase_C PHD zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-C3HC4 zf-RING_5 DUF2732 PEP-utilisers_N
Motif
Other DBs
NCBI-GeneID: 308282
NCBI-ProteinID: NP_001100940
RGD: 1310342
Ensembl: ENSRNOG00000014450
UniProt: D4A9B2
Position
1p13
AA seq 1701 aa AA seqDB search
MSSRRKRAPPMKVDEERQQQLRWNMHEDLRNEPLSLTEEERACWDADSSDCIIIDDDPPE
GAAHRDKKRCTESVSILNSTEKETPLSVALNVTISPHPSDDSWKAFLGDFVLQLLPEESL
VEHFSERTFTLMSSESSSQLLIYVHSECNNVEKEENVLKGPASIYGKGIRVESSFSSDML
QDLAWLQKRRGIKLYQRPEGTHTIKVRIYLLEAGLTRLDFMSDAGSRMKKFNQLLKRVMG
KLYSLSIPDVLEEDEEESESEPEGQDIDELYQFVKRTHQQEAKSVQVDVQHPALIPVLRP
YQREAVNWMLQQEQFRSTPADNSLHFLWREIVTPDGLNLYYNPYTGCIIRDFPHAGPQLL
GGILADEMGLGKTVEVLALILTHTRQDVRQDALTLPEGKVVNYFIPTHCPRGKVKSREIQ
NTECEPKEKVHCPPTRVMILTAVKEMNGKKGVSILSIYKYVSSTFRYDVQRNRSLLKRML
KCLIFEGLVKQIKGRGFSGTFTLGKNYKEDVFDKTKKQAVGSPQKIEKELRKSVNKDTDS
EYMPSDIYDDDNDNDDDDDDDPYYYYCKARKSRKLKKKPVLLTKKEKGQPVNLDSQVEAP
AAGDCASADAHVSESTCVSENRQIQDAEDCVESPSPAAMELAQSNTASFCETPDYRFECI
CGEFDQIGRKPRVQCLKCHLWQHAKCVNYEEKNLKVKPFYCPHCLVAMEPVSTRATLIIS
PSSICHQWVDEINRHVRSSSLRVLVYQGVKKDGFLQPHFLAEQDIVIITYDVLRSELNYV
DIPHSNSEDGRRLRNQKRYMAIPSPLVAVEWWRICLDEAQMVECPTVKAAEMAQRLSGIN
RWCVSGTPVQRGLEDLFGLVVFLGIEPYCVKHWWIRLLYHPYCKKNPQHLYSFIAKIMWR
SAKKDVIDQIQIPPQTEEMHWLHFSPVERHFYHRQHEVCCQDAVVKLRKISDWALKLSSL
DRRTVSSILYPLLRLRQACCHPQAVRGEFLPLQKSTMTMEELLTSLQKKCGTECEEAHRQ
LVCALNGLAGIHIIKGRRAQYRAALALPPPECVILSEYALAAELYREVLRSSEEHKGKLK
TDSLQRLHATHNLMELLVAKHPGIPPTLRDGRLEEEAKQLREHYMSKCNTEVAEAQQALQ
PVQQSIRELQRKVHSGSPWWLNVVHRAMEYAVDEELVQRVRNEISSNYKHQTDKLSMSEK
FRDCRGLQFLLTTQMEELHKFQKLVREAVKKLEKPPSRDVIESATVCHLRPARLPLNCCV
FCKADELFTEYESKLFSNTVKGQTAIFEEMIEDEEGLVDDRVPTTTRGLWAVSETERSMK
AILSFARSHRFDVEYIDEGSVSMDLFEAWKKEYKLLHEYWMTLRNRVSAVDELAMATERL
RVRHPKEPKPNPPVHHIIEPHEVEQNRIKLVNDKAVATSQLQKKLGQLLYLTNLEKSQDK
TSGGINPEPCPICARQLGKQWAVLTCGHCFCNECTSIIIEQYSVGSHRSSIKCAICRQTT
SHKEVSYVFTSEKANQEDDIPVKGSHSTKVEAVVRTLMKIQLKDPGAKALVFSTWQDVLD
IISKALTDNNMGFTQISRIKTFQENLSAFKYDPQINILLLPLHTGSNGLTIIEATHVLLV
EPILNPAHELQAIGRVHRIGQTKPTIVHRFLIKATIEERMQAMLKTAERSHTSSSGKHSE
ASALTVADLADLFTKESEELE
NT seq 5106 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccgaaggaaacgtgctcccccgatgaaggtggatgaagaaaggcagcagcag
cttcgctggaacatgcacgaggacctgaggaatgagccgctcagcttgactgaggaagag
cgggcctgctgggatgcagactcctccgattgcatcatcatagatgatgaccctcccgaa
ggtgcagctcacagagataagaagaggtgtacagagtctgtgagcatcttaaactccact
gaaaaagagacccctctgtccgtggccttgaatgttaccatttctccccatccttccgat
gattcttggaaagcgtttctgggagattttgtgcttcagcttctccctgaagagagttta
gttgaacatttttctgaaaggacttttacgttgatgagttcagagtcaagcagtcagctc
ctgatctatgttcattcagaatgtaacaatgtggagaaagaagaaaacgtacttaaagga
ccagcaagtatctatggcaagggtattcgagtggaatcctccttcagtagtgacatgtta
caggatttggcctggctacagaagagaagaggaataaaactctaccagcgaccagaagga
actcatacgatcaaggttagaatttacctcttggaagctggcctgacaagactagacttc
atgagtgatgcaggctccagaatgaaaaagttcaatcagctcctgaagagagtgatggga
aagttatacagtctcagtattccagatgtgttggaagaagatgaggaggaatcagagagt
gagccagagggccaggacattgatgagctctatcagtttgtgaagcgaacacaccagcaa
gaggcaaagtcagtccaagtggatgtccagcaccctgcactgattccggtgctgaggccg
taccagagagaggcagtcaactggatgctacagcaggagcagttcaggagcactcctgct
gataactccctgcacttcttgtggcgagaaattgttacacctgatggcttgaacctctac
tataatccgtacacaggctgcatcattcgggacttcccacatgctgggccacagttgctc
ggtggaatcttagcagatgagatgggcctcgggaagacagtggaggttctggctctgatt
ctgactcatacccgacaagatgtcagacaggatgccctcaccctgcctgagggaaaagtg
gtaaattatttcatcccaactcattgtcctagaggaaaagtgaaaagtagagaaatccag
aatacagagtgtgaaccaaaagagaaagttcactgccctcccacacgtgtgatgattctg
acagctgtgaaagaaatgaatgggaaaaaaggcgtttctattctttctatctataagtat
gtcagctccacattcagatacgacgttcagcggaaccggagtcttctgaagcggatgttg
aaatgtttaatctttgaaggtcttgtgaaacagattaaaggccgtggtttctctgggact
tttacactgggaaagaattacaaagaagatgtatttgataaaacgaaaaagcaggcagta
gggagtccacaaaaaattgagaaagagttaaggaaatcagtgaacaaggatacagattct
gaatacatgccatcagacatttatgatgacgataatgacaacgacgatgacgacgacgat
gatccttattattattactgcaaggcaagaaaaagccgtaagttgaagaagaagcctgtg
ttactcactaaaaaggaaaagggtcagcctgtcaatctggattcccaagttgaggctcca
gctgctggtgactgtgcaagcgccgatgctcatgtgtcagaaagtacatgtgtctctgaa
aacaggcagatccaagacgcagaggactgtgttgagtctccaagcccggccgccatggag
ctggcacagtctaacactgcaagtttctgtgagacccctgactaccgctttgagtgtata
tgtggtgaatttgaccagatcggccgcaagccaagagttcagtgtctgaagtgtcacctg
tggcagcatgcaaagtgtgtgaattacgaggagaagaatctgaaggttaagcctttttac
tgccctcattgcctggttgcaatggagccagtgtcaaccagagcgactctcatcatctcc
ccaagctccatttgccaccagtgggtagatgaaatcaaccggcacgtgagatcgtcatcc
cttcgagttttggtatatcaaggagtgaagaaagatgggttcttacagcctcattttttg
gcagaacaagatatagttatcattacctatgatgttctccgttcagaattaaactatgtc
gatatcccacatagcaatagtgaagatgggcgtcgcctgaggaaccagaagcgctacatg
gccattcccagccccctggtagcggtggagtggtggcggatctgtctggatgaagcgcag
atggtcgagtgtcctacagtaaaagctgcagaaatggcccagcgtttgagtggcattaat
cggtggtgtgtcagtggcactccagtgcagagaggattggaagatctttttgggctggtg
gtctttcttgggattgaaccttattgtgtcaaacactggtggattcgacttctctatcat
ccatactgcaagaaaaatcctcaacacctgtacagttttattgctaagataatgtggagg
tccgcaaagaaagatgtcattgaccaaatccagatcccacctcagactgaagaaatgcac
tggctccatttttcccctgtggagaggcatttctaccaccgccagcatgaggtgtgctgc
caggatgctgtggtaaagctcaggaagatctcggactgggccctgaagctgagcagcttg
gacagaaggacggtctcctccatcctgtaccccctgctgagactcaggcaggcctgctgc
cacccacaggctgtgcgtggggagttcctgccactccagaagagcaccatgacgatggag
gagttgctgacatctttgcagaagaagtgtggaacagagtgtgaagaggcccaccggcag
ctagtttgtgcccttaacggcttagcaggcatccacatcattaaaggtagaagagcacag
tacagagcagcccttgctttgcctcccccagaatgtgtcattcttagtgaatacgccttg
gcagcggaactctacagagaagttttaaggtcgtctgaggagcacaaaggaaaactcaaa
actgattcacttcaaagacttcacgccacacataacctgatggagctcctggtagccaaa
cacccagggataccgcccaccctgagagatggcagacttgaagaagaggccaagcagctc
cgagagcactacatgagcaagtgtaacacagaggtggccgaagcccagcaagctttgcag
cctgtgcagcagtccattcgggagctccaaaggaaggttcattctggttctccttggtgg
ctgaatgtagttcacagagcaatggagtatgctgttgacgaggagcttgttcagcgcgtg
cgaaatgagataagcagtaactacaagcaccaaacggacaaactctccatgtcagagaag
ttccgtgactgtagaggtcttcagttcttacttacaacacaaatggaagagctgcacaag
ttccagaagctagtgagggaggctgtgaagaagctggagaaacctccgtcccgggatgtg
attgagtctgcaacagtttgccacctgcggccagctagactccctctcaactgctgtgtc
ttttgtaaagctgatgaattgttcacagagtatgagtcaaagctattttctaacactgtc
aaaggccagaccgccatctttgaagaaatgatagaagatgaagaaggactcgtggatgat
agagtccctaccactaccagaggcctgtgggccgtgagcgagacggagcgatctatgaaa
gcaatactatcatttgcaagatcacataggtttgacgttgaatatatagatgaaggaagt
gtttcaatggatctcttcgaggcatggaagaaggagtataagttacttcatgaatactgg
atgactctgagaaaccgcgtatccgctgttgatgaacttgcaatggctacagagcgacta
agagtgcgccatcccaaggagccaaagccaaacccacccgtccaccacatcattgaacca
cacgaggttgaacagaatcgtataaaactagtaaatgataaagctgttgctacttcccag
cttcagaagaaacttggacagcttctttacctgacaaatttggagaagtctcaggacaaa
acatcaggaggtattaatccagagccttgtccgatctgtgctcggcagttgggaaaacag
tgggcagtgctgacctgcggacactgcttctgtaatgaatgcacttcaattataattgaa
caatacagtgtgggatcccatcgaagctccattaagtgtgctatctgccgccagaccaca
tcacacaaagaagtctcctatgtcttcacttcagagaaggcaaaccaagaggatgatatc
cctgtgaagggtagccattctacaaaagtggaagctgtggtcagaactctgatgaaaata
caacttaaagatccgggggccaaagcgctcgttttctcaacgtggcaagatgtgttagat
attatttcaaaagctctcacggacaacaacatgggattcacacaaatcagtcgcattaag
acattccaggagaacctttcagcatttaaatatgatccccagatcaatattttgctgctg
cccctgcatacaggctctaatggattaactatcattgaagccactcatgtcctcctggtg
gaaccgatactgaatcctgcccatgagcttcaggccattgggagagtgcaccgaattgga
cagacaaaacctactattgtacatagattcttaattaaagcaacaatagaagagcggatg
caggcaatgctaaagactgctgagaggagccacaccagctcgtctgggaagcattctgaa
gcctctgcactgaccgtggctgacctggcagacctgttcaccaaagagagtgaggagctt
gaatga

DBGET integrated database retrieval system