KEGG   Rattus norvegicus (rat): 308291Help
Entry
308291            CDS       T01003                                 

Gene name
Phactr2
Definition
(RefSeq) phosphatase and actin regulator 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RPEL
Motif
Other DBs
NCBI-GeneID: 308291
NCBI-ProteinID: NP_999623
RGD: 1303141
Ensembl: ENSRNOG00000015473
UniProt: P62025
Position
1p13
AA seq 569 aa AA seqDB search
MGQTSVSALSPQPGSVDGLDKASIANSDGPPAGSQTPPFKRKGKLSTIGKIFKPWKWRKE
KTSDKFRETSAVLERKISTRQSREELIRRGLLKELPDQDGDVTVNFENSNGHMIHIGEEA
TQEENVGKPEEGNVSVCEKGPPREEQAEEKTAGSSHPKKTTGSKASSSPSASSTSSHPRG
PKESLTGKAGAVGTTRGKKKISKQPAAAASRLSPNTVTSETSSLKGELSDTGVESLKPEE
TVAGAEEEATGKPKAVVVALPPVTVPPSSPALPLPPEDPCTIALDTPMVLVSDGPTLPIS
ALETSPLPGTEEPANRTTPYSSTGLGGSREQAKCFTTKDGLGKAGPQLLTPGQMGDSLES
FSAPEDEAPREYQANDSDSDGPILYTDDDDEEDDDDDSTGESALASKIRRRDTLAIKLGN
RPSKKELEDKNILQRTSEEERQELRQQIGTKLVRRLSQRPTTEELEQRSILKQKNEEEEQ
EAKMELKRRLSRKLSLRPTVPELQARRILRFNEYVEVTDSPDYDRRADKPWARLTPADKA
AIRKELNEFKSTEMEVHEESRQFTRFHRP
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgggccagacctcggtgtccgcgctgtccccgcagcccggcagcgttgatggactagac
aaagcctccatagcaaactcagatggccccccagcaggttcccagacacctcccttcaag
agaaaggggaaactctccaccattggtaaaatcttcaagccttggaaatggaggaaagag
aagaccagtgacaagtttagagagacctcagcagtattagagaggaagatatccaccaga
caaagtagagaggagctgataagaaggggcctgcttaaggaattgcctgatcaagatgga
gatgtaacagttaactttgaaaattcaaacgggcacatgatacacatcggagaggaagct
acccaagaggagaatgtagggaaacctgaagaagggaatgtctctgtgtgtgagaaagga
ccacctcgagaggaacaggcagaagagaagacagctggttcctctcacccgaagaaaaca
actggttccaaagcctcatcctcaccatctgcttcgtccacctcctctcatcccagagga
cccaaggagtcactcactggcaaagcaggcgcggttgggaccacaaggggcaagaaaaag
attagcaagcagccagcagcggcggcatcccgactgtcccccaacacagtcacttctgaa
acgtctagtcttaaaggagagctctcagacactggggtagagagcctcaagccagaggaa
actgttgctggagcagaggaggaggccacaggcaaacccaaggcggtcgtcgtcgctctg
ccacctgtcacagtaccgccatcttcacctgcccttcctctgccccctgaggatccatgc
actattgccttggacactcccatggtcctagtcagtgatggacccaccctgcccatctct
gccttagaaacaagtccgctccctgggactgaagaaccagcgaacagaaccactccgtac
tcaagcaccggcttaggtgggagccgagagcaggcaaaatgttttacaaccaaagatggg
ctgggaaaggctggacctcaattgctgacccctggacagatgggagactcattagaatcc
ttcagtgccccagaggatgaggccccaagagagtaccaagccaatgactctgactcggat
ggacccatcttatacacagatgatgatgatgaagaagatgatgatgatgacagcactgga
gaaagtgcattggcaagtaagatcagacgaagggatacactcgccatcaaacttggcaac
agaccatccaagaaagagctagaggacaaaaacatcctgcagcgaacgtctgaagaagaa
aggcaggagctgcgacaacagataggaaccaagctggtcaggagactcagccagaggcca
accactgaagaattagagcagagaagcatcttaaaacaaaagaatgaagaagaggagcag
gaagcaaaaatggaactcaaacggaggctcagccggaagctcagcctaagacctactgtg
ccagagctacaagcccgaagaatcctgcggtttaatgagtatgtggaagtcacagattcc
ccggactacgacagacgtgcggacaagccctgggccaggttgacacctgcggacaaggca
gcaataaggaaagaactaaatgaatttaaaagcacggaaatggaagttcacgaagagagt
cgacagtttacaaggtttcaccgtccataa

DBGET integrated database retrieval system