KEGG   Rattus norvegicus (rat): 308335Help
Entry
308335            CDS       T01003                                 

Gene name
U2af2
Definition
(RefSeq) U2 small nuclear RNA auxiliary factor 2
  KO
K12837  splicing factor U2AF 65 kDa subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    308335 (U2af2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    308335 (U2af2)
Spliceosome [BR:rno03041]
 Complex A
  U2 snRNP components
   U2 related factors
    308335 (U2af2)
 Complex B
    308335 (U2af2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_occluded RRM_7 Transformer
Motif
Other DBs
NCBI-GeneID: 308335
NCBI-ProteinID: XP_001060115
RGD: 1310690
Ensembl: ENSRNOG00000015914
UniProt: F2Z3T9
Position
1q12
AA seq 471 aa AA seqDB search
MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRR
RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATA
LLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQ
APGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
NPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSK
GYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLM
SSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGV
EVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacttcgacgagttcgagcggcagctcaacgagaataaacaagaacgggacaag
gaaaaccggcaccggaagcgtagtcatagtcgctctcgaagccgggaccgaaagcgcagg
agccggagccgagatcggcgtaaccgggaccagcgcagtgcctcccgggacaggagacga
cgaagcaaacctttgaccagaggcgctaaagaggagcacggtggattgattcgttccccc
cgccatgagaagaagaagaaggttcgtaaatactgggacgtgccaccgcctggctttgag
cacatcaccccaatgcagtacaaggccatgcaagctgcgggtcagattccagccactgcc
cttctcccgactatgactcctgatggtctggctgtgaccccaacgccagtgcctgtggtt
gggagccagatgaccagacaggccagacgtctctacgtgggcaacatcccttttggcatc
actgaggaggctatgatggacttcttcaacgcccagatgcgcttgggggggttgactcag
gcccctggcaacccagtcttggctgttcagataaatcaagacaagaattttgcctttttg
gagttccggtcagtggatgagacgacccaggccatggcctttgatggcatcatcttccag
ggccagtcattgaagattcgaaggcctcatgactaccagccactgcctggcatgtcagag
aacccctctgtttatgtgcctggagttgtatccactgtagtcccagattctgcccataag
ctgttcatcgggggcttgcccaactacctgaatgatgaccaggtaaaagaactgctgaca
tcctttgggcctctaaaggccttcaacttggtcaaggatagtgccacagggctctccaag
ggctatgccttctgtgagtacgtggacatcaacgttacagatcaggctattgcggggctg
aatgggatgcagctaggggacaagaagctgcttgtccagagggcgagtgtgggagccaag
aatgccacgctgagcaccatcaatcagacacctgtgacccttcaagtgcccggcctgatg
agctctcaggtgcagatgggcggtcacccaactgaggtcctgtgcctcatgaacatggtg
ctccctgaggagctgctggacgatgaggaatatgaggaaattgtagaggatgtacgagac
gagtgcagcaagtatgggctggtcaaatccattgaaattcctcggcccgtggatggcgtc
gaggtgcctggctgcggaaagatctttgtggagttcacctctgtgtttgactgccagaaa
gccatgcagggtctaaccggccgcaagttcgccaacagagtggtggtcacaaaatactgt
gaccctgactcgtaccaccgtcgggacttctggtag

DBGET integrated database retrieval system