KEGG   Rattus norvegicus (rat): 308341
Entry
308341            CDS       T01003                                 

Gene name
Ssc5d, RGD1565772
Definition
(RefSeq) scavenger receptor cysteine rich family member with 5 domains
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SRCR SRCR_2
Other DBs
NCBI-GeneID: 308341
NCBI-ProteinID: NP_001128017
RGD: 1565772
Ensembl: ENSRNOG00000016687
UniProt: D3ZPK4
Position
1q12
AA seq 1436 aa
MRVLACLLAMLVGIQAIERLRLADGPHGCAGRLEVWYSGRWGTVCDDGWDLRDAAVACRV
LGCGGALAAPGGAFFGEGTGPVWLSELACRGSEGQLGICPHRGWKAHICSHEEDAGVVCV
GQRAANSREDSVSLLDGDPWLALSGELSPSSEEPPITHAPQPAASSQNGPRKKNPRPPKQ
VKSTRAPVLTNGAPRQERLRLVSGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACREL
GCGGALAAPGGARFGPGEGPVWMDDVGCGGGEEALRDCPRSPWGRSNCDHTEDAGLVCTG
PAPRLRLADGPHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACRELGCGGALAAPGGAFF
GEGAGPIILDDLRCRGNETALRFCPARPWGQHDCHHREDAGAVCDGMPLGGDVQPTAPAV
DSNRTTPRLQSTSVGHTPGPAGSWPPPASPTAPPEPGPEAGSPQLRLVAGPSRCSGRLEV
WHDGRWGTVCDDSWDMRDSAVVCRELGCGGPRQPDPAAGRFGWGAGPIWLDDVGCVGTEA
SLSECPAASWGKHNCAHNEDVGVTCTGTPGLDTISDPFSWSWLPGLGRDQDAWLPGELAT
KPSASLTSSVLQKTTKAPGKVPKSTKKWVTKNAKRPTTQPPGIPITKRPRVPGTPTSLSP
TPRTSELPKRLTAEAPRRQTSHTTERLTPRVPWEWTSETAASLSTQGPQEVTSEATTAQT
PQTSLEPFGENPEGSLESSQDPAATPTAGVPVPSGPFRVRLADGPNRCAGRLEVWHAGLW
GTVCDDSWDLRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMGCKGSETSLSDCPS
GTWGKHNCDHEEDVVLTCTGYTGDDDYPSWTWDPTSEEDLTKRTTVATQPGHTPSWATTT
NPEVLSPATQSLPDIDDQGSYELSWTWDTPSGRSLSKGTPTTTKPGSTVTTSTRKSPGHP
FPAPRARANTGLPRKPKPERRTLQPTSARTTHTTSSPASYTSPEPSGSQQTSGSWPQLFP
DLASKQEGTSTPPKTSPLTPGLPSPTNFALSTTDASLLPTRPPELSGSPTSNSPEGLTSD
SPMLLEVSSLSPTSELTPGSDMTPDLGTAPKIIPESSESSDLPTSPSTHTQPFTASYPTS
IPHPTTIPHPTTTPHPRAPSHPTTIPQLNTTSYPTMALQPTTNPQHPGSPHPTTSPQPPT
NTHSSSTSATPTKSLPSSPETEFSSPTPQPRVKPSLHPDLTFVGVPPTGKSQMQNLEFSL
ASESGPSRPSPAPSMDPLSTEVFKPPRSQTLHSVSEPMVTADLAISSMAHPSDQPPPDRL
AQGPTSNHNPGPFGPCVSSVPPVRVMACEPPALVELVAAVREVGDQLQRLTRVLEQDRQE
RQVLGLGLVKLVEAAQGLGQLSETVKRLAEVAWPPSTPVPTTTTTEEEERPLRGDV
NT seq 4311 nt   +upstreamnt  +downstreamnt
atgagggtcttggcgtgtcttcttgcaatgctggtggggatccaggctatagagcgactc
cgcctggctgatggccctcatggctgtgcaggacgcctggaggtctggtacagcgggcgc
tggggcaccgtgtgtgatgacggatgggaccttcgggatgctgcagtggcctgccgtgtg
ttgggctgcggaggggcgctagccgcccccgggggtgccttctttggggagggcactggg
cccgtgtggctcagtgagctggcctgtcggggcagtgagggacagctgggtatctgtccc
caccggggctggaaggctcatatctgctctcacgaggaggacgcgggcgtcgtctgtgta
ggtcagcgtgcagctaactctagagaagactcagtgtccctgctggatggggacccatgg
ctggcactgtctggggagctgagccccagctcagaggagccccctataactcatgctccc
cagccggcagcaagctcccagaatggcccccgaaagaagaacccccggccacccaagcag
gtcaagtccacccgagcccctgtactgacaaatggagctccccgccaagagcggctgcgt
ctggtctcaggtccccatggatgtgccggccgcctggaagtctggcacggtggacgttgg
ggtactgtctgcgatgatggatgggacctccgagacgcagcagtggcctgtagggagcta
ggatgtgggggagcgctggccgcccctggaggtgccagattcggacctggtgagggaccc
gtgtggatggacgatgtcgggtgtggaggaggagaggaggccctccgggactgtccccga
agcccctggggccggagcaactgtgaccacacagaggatgcagggctggtctgtactggt
cctgcacccaggttgcgccttgctgatggtccccacggctgtgctgggcgcctggaggtt
tggcatggtggccgctgggggtcggtatgtgacgatgcttgggatcttcgtgatgccgct
gtggcctgcagggagctgggctgtgggggtgccctggctgccccagggggtgccttcttt
ggtgagggggctggacccatcatcctggatgacctcagatgtcgaggaaacgagacagcc
ttacgattctgccctgcgaggccctggggtcagcatgactgtcaccatcgggaggatgct
ggggctgtgtgtgatggcatgcctctcggtggcgatgtgcagcctacagctcctgcagtg
gacagcaacagaacaacacccaggctccagtctacctcagtgggtcatacgccaggccca
gcaggcagttggcctcctcctgcttctcctactgcccctccagagcctggacctgaagct
gggtccccccagttgcgcctggtggctggacccagcaggtgctctggtcggctggaggta
tggcatgatggacgctgggggacagtatgtgatgacagctgggacatgagagactcagct
gtggtctgccgggagctgggctgtggggggccccgacagccagaccctgcagcaggccgc
tttggctggggcgcaggccccatctggctggatgatgtaggttgtgtggggacggaggct
tcactgtcagaatgccctgctgcttcctgggggaaacacaattgcgcccacaatgaggat
gtcggggttacctgcaccgggacccccggcctggacaccatctcagaccctttcagttgg
agctggctccctgggctgggtagagatcaggatgcctggctcccaggagagctggccacc
aagccttctgccagtctcacctccagtgtgctacagaaaaccacaaaggctccagggaaa
gtgcccaagagtaccaagaagtgggtgactaaaaatgcaaagagaccaaccactcagccc
cctgggataccaatcactaaacgccccagggtcccaggcaccccaacctccctaagccca
accccacgtacctctgagttaccaaagagacttactgccgaggctcctcgcagacagacc
tcacacaccaccgaaaggctgacccctagggtcccctgggagtggacctcagagaccgcg
gcatcactgtccactcaaggcccccaagaagtgacctctgaggccaccaccgcacaaacc
cctcagacctccttggagccatttggtgagaacccagaaggctctctagaatcttcccag
gatccagctgccaccccgactgctggagttcccgtgccatcgggtcccttccgggttcgt
ctggctgatgggcccaacaggtgtgctggccggctagaggtgtggcatgccgggctctgg
gggacagtctgtgatgacagctgggacctccgggatgccacagtggcctgctgggaactg
ggttgcggaaaggtccggccccgagtaggcaaaacccactatggccctggcactgggccc
atctggttggatgacatgggctgtaagggaagtgagacgtcactgagtgactgcccctcg
gggacatgggggaagcacaactgtgaccacgaagaagacgtggtgctcacctgcactggc
tacacaggggatgacgattacccttcctggacctgggaccccacttcggaagaggacctg
accaaaaggaccacagtggccacacagcctggacatacaccttcctgggctactaccaca
aaccctgaagttctctctccagcaacgcagagccttccagacatagatgaccagggtagt
tatgagctctcctggacatgggatacaccttcaggaaggagtctgtccaaagggaccccc
accacaaccaaacctggatccacagttaccactagcaccagaaagagtccaggccatccc
tttccagctccaagggcccgtgcaaacacaggtttaccaaggaagccaaaacctgagcgc
cggacgctgcagcccacctcagccaggacgacacacaccacctcatccccggcttcctac
acctcaccagagccttctggctcacagcagacctctggctcctggccacaactcttccca
gacttggcttcaaagcaggaggggacgtctacccctcccaaaacatctccactcacccca
ggacttccctccccaacaaactttgccttgtccactactgatgccagtttgcttccaaca
cgtcccccagagctttcaggcagcccaacatccaactcccctgaagggctaacctctgac
tcccccatgctattagaagtgagcagcctttcccctacctcagagctgacgccaggatct
gacatgacaccagacctgggcacagcacccaaaataatcccagaaagttctgagtcctca
gacctccccacgagccccagcacccacacacaaccattcacagcctcttaccctaccagc
atccctcaccccaccaccatccctcatcccaccactacccctcatcctagagccccctcc
caccccaccaccatccctcaactcaacacaacttcctaccccaccatggccctgcaacct
accaccaaccctcagcatcccgggagccctcatcccaccacaagtcctcaacctcccacc
aacactcactcttcttcaacctctgccacccccacaaagtcccttccatcctccccagag
acagaattttcctctcctactccacaaccaagggtcaagcctagcctacacccagatctg
acctttgtaggagtcccgcccacaggcaaatcccagatgcagaacctagagttctctcta
gcctcagagtctggcccctccaggccctctccagccccaagcatggacccactatccaca
gaggtcttcaaaccacccagaagccagaccttacactcagtttcagaacccatggtgacc
gctgaccttgccatctcctctatggcccacccatctgaccaacctcccccagatcgcctc
gctcaagggccaacttctaatcacaacccaggtccctttgggccatgtgtctcctcagta
ccacctgtaagggtcatggcttgtgagccacctgccttggtggagctggtggctgctgtg
agggaggtgggtgaccagctgcagaggctgacccgggtcctggagcaggaccggcaggag
cgccaagtcctggggctgggcctagtcaagttggtagaggctgcccaggggttggggcag
ctaagtgagactgtaaagaggcttgcagaggtggcctggccccccagcacacctgtgccc
acaaccaccaccacagaggaggaggagaggcctctgagaggagatgtgtga

DBGET integrated database retrieval system