KEGG   Rattus norvegicus (rat): 308390Help
Entry
308390            CDS       T01003                                 

Gene name
Fkrp
Definition
(RefSeq) fukutin related protein
  KO
K19873  fukutin-related protein [EC:2.7.8.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00515  Mannose type O-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    308390 (Fkrp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    308390 (Fkrp)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     308390 (Fkrp)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    308390 (Fkrp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LicD
Motif
Other DBs
NCBI-GeneID: 308390
NCBI-ProteinID: NP_001020849
RGD: 1305852
Ensembl: ENSRNOG00000016055
UniProt: Q4KLJ4
Position
1q21
AA seq 494 aa AA seqDB search
MRLTRCWAALAAAIILNLLVFFYVSWLQHQPRNSRTRGPRRTSAIGPRVTVLIREFEAFD
NAVPELVDSFLQLDPAQPVVVAADTLPYPPLALPRIPNVRLALLQPALDRSAAASRPETY
VATEFVALVPDGARAESPGHLERMVEALRGSSARLVAAPVATTNPARCLALNVSLREWTA
RYGPAPSAPRCDALDGDAVLLMRSRDLFNLSVPLARPLATSLFLQTALRGWAVQLLDLTF
ASARQPPLATAHARWKAEREGRSRRAALLRSLGIRLVSWEGGRLEWFGCSKESPRCFGTV
VGDTPAYLYEGRWTPPCCLRALRETARYVVGVLEAAGVRYWLEGGSLLGAARHGDIIPWD
YDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDFFRVQYSESNHLHVDLWPF
YPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLAFAGFMAQAPNNYRRFLELKFGPGVIEN
PEYPNPALLSLTGG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcacccgctgctgggctgccctggcagcagccatcatcctcaacctcctagtc
ttcttctatgtgtcatggctacaacaccagcccagaaactcccggacccggggcccacgc
cgcacttctgccattggtccacgagtcactgtcctgattcgggaatttgaggcttttgac
aacgcggtgccggagctagtggattccttcctgcagctggacccagcccagcctgtggtg
gtggccgccgacacactcccttacccacccctggccttgcctcgcattcccaacgttcgc
ctggccctgctccagccagctctggaccggtcagcggcggcctcgcgcccggagacatat
gtagccacagagttcgtggccctggtgcctgatggagcgcgggccgagtcaccaggacat
ctggagcgaatggtggaggcgctccggggaagcagcgcgcgcctcgtagccgccccggtc
gccactaccaacccagcgcggtgcctggcactgaacgtcagcttgagggagtggactgcg
cgctacggcccagcgcccagcgcgccccgctgcgacgctttggatggcgacgcggtgctg
ctgatgcgctcccgcgacctcttcaacctctcggttcccctggcacggccgctggccacc
agcctcttcctacagaccgccctgcgcggctgggcagtgcagttgctggatttgactttc
gcctcggcgcgccagccccctctggccaccgcccacgcgcgctggaaggcggaacgcgag
gggcgctcacggagggcggcgctgctgcgctctcttggtatccgcctggtgagctgggaa
ggcggacggctcgagtggtttggctgcagcaaggagagcccgcgctgcttcggtacggta
gtgggcgacacacccgcctacctgtacgagggccgctggacaccaccttgctgcctgcgc
gcactgcgggagactgcgcgctacgtggtgggcgtgctggaggcggcaggcgtgcgctac
tggttggagggcggctcgctgctgggtgcagcccgccatggcgacatcatcccgtgggac
tacgacgtagatctgggcatctacctggaggacgtgggcaactgcgaacagttgcggggc
gcagaggctggctcggtagtggatgaacgaggcttcgtgtgggagaaggcggtggagggc
gacttcttccgagtgcagtacagcgagagcaaccacctgcacgtggacctgtggcccttc
tacccacgcaatggggtcatgaccaaggacacatggctggaccaccggcaggatgttgag
ttcccagagcacttcctgcagccgctggtcccactggcctttgcgggtttcatggcacag
gcccctaacaactaccgccgcttcctggagctcaagtttgggcctggggtcatcgagaac
ccggagtaccccaaccctgcactcttaagcttgacaggtggctga

DBGET integrated database retrieval system