KEGG   Rattus norvegicus (rat): 308408Help
Entry
308408            CDS       T01003                                 

Gene name
Gpr4
Definition
(RefSeq) G protein-coupled receptor 4
  KO
K04312  G protein-coupled receptor 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    308408 (Gpr4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Proton-sensing GPCRs
    308408 (Gpr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv PgaD DUF3429
Motif
Other DBs
NCBI-GeneID: 308408
NCBI-ProteinID: NP_001020851
RGD: 1311604
Ensembl: ENSRNOG00000016362
UniProt: Q4KLH9
Position
1q21
AA seq 365 aa AA seqDB search
MDNSTGTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQRNELGVYLMN
LSIADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYSNIYISIAFLCCISVDRYLA
VAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMERWV
AWMNLYRVFVGFLFPWALMLLCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFA
PYHALLLSRSAVYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVA
KALHNLLRFLASNKPQEMANASLTLETPLTSKRSTTGKTSGAVWAVPPTAQGDQVPLKVL
LPPAQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggacaacagcacgggcacgtgggagggctgccatgtggactctcgagtggaccacctc
ttcccaccatccctctacatcttcgtcatcggggtggggctgcccaccaactgcctggcc
ctgtgggcagcctaccgccaggtgcgccagcgcaatgagctgggcgtctacctgatgaac
ttgagcatcgcagacctgctgtacatctgtacgctgccgctgtgggtcgactacttcctc
caccatgacaactggatccacggccccggctcctgcaagctctttggcttcatcttctac
agcaacatctacatcagcatcgccttcctgtgctgcatctccgtggaccgctacctggct
gtggcccatccgctgcgctttgcgcgcctgcgccgggtcaagacagcagtagctgtgagc
tccgtggtctgggccaccgagctaggcgccaactcggcaccgctctttcatgacgagctc
tttcgtgatcgctacaaccacaccttctgcttcgagaagttccccatggagcgctgggtg
gcctggatgaacctgtaccgcgtctttgtggggttcctcttcccctgggcactcatgttg
ctgtgctaccgcggcatcctgcgggccgtacagagcagtgtgtccaccgagcgccaggag
aaagtcaagatcaaacgcctggccctgagcctcatcgccatcgtgctggtgtgctttgca
ccctaccatgctctcttgctgtctcgcagcgctgtctatctgggccggccctgggactgt
ggcttcgaggagcgagtcttctctgcctaccacagctccctagccttcaccagcctcaat
tgcgtggctgaccccatcctctactgcctggtcaacgagggtgcccgtagtgacgtggcc
aaagccctgcacaacctcctccgcttcctggccagcaacaagccccaggagatggccaat
gcttccctcaccctggagacaccattgacctccaagaggagcaccaccggcaaaacgtct
ggggctgtctgggcagtgcctcccactgcccagggggaccaggtgccactgaaggtgctg
ctgcccccggcacagtga

DBGET integrated database retrieval system