KEGG   Rattus norvegicus (rat): 308440
Entry
308440            CDS       T01003                                 

Gene name
B3gnt8
Definition
(RefSeq) UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
  KO
K09665  beta-1,3-N-acetylglucosaminyltransferase 8 [EC:2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    308440 (B3gnt8)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     308440 (B3gnt8)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   308440 (B3gnt8)
SSDB
Motif
Pfam: Galactosyl_T
Other DBs
NCBI-GeneID: 308440
NCBI-ProteinID: NP_001100962
RGD: 1305374
Ensembl: ENSRNOG00000020606
UniProt: D3ZE36
Position
1
AA seq 389 aa
MRCRKCQLCLSALLTLLGLKVYIEWTSESWLKKAEPRGALPSPTPPSAEPTLPTNLSARL
GQTGPLSSAYWNQQQRQLGVLPSSDCQTWGSVAASEILDFILYPQDLRRFLLSAACRSFP
LWLPAGEGSPVASCSDKDVPYLLLAVKSEPGHFAARQAVRETWGSPVAGTRLLFLLGSPL
GMGGPDLTSLVTWESRRYGDLLLWDFLDVPYNRTLKDLLLLTWLSHHCPKVSFVLQVQDN
AFVHIPALLEHLQALPPTWARSLYLGEVFTQAKPLRKPGGPFYVPKTFFEGDYPAYASGG
GYVISGRLAPWLLQAAARVAPFPFDDVYTGFCFRALGLAPRAHPGFLTAWPAERTRDPCA
VRGLLLVHPVSPQDTIWLWRHLWVPELRC
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcgttgccgcaagtgccagctctgcctgtcagcactgctcacactcctgggcctcaaa
gtatacatcgagtggacatctgagtcctggcttaaaaaggctgaaccccggggcgctctg
cccagtccaacgccaccaagtgctgagcccaccttgcccaccaacctctcagcacgcctg
ggtcagactggcccactgtcctctgcttattggaaccagcagcagcggcaactgggcgtc
ctgccgagttcggactgtcagacttgggggagtgttgctgcctcagagatcttggacttc
atcctgtacccccaagaccttcggcgcttcttgctgtcagcagcctgtaggagcttcccg
ctatggctgcctgcaggagaaggcagcccggtggccagctgctctgataaggatgtaccc
tacttgctactggctgtcaaatcagaaccaggacactttgcagcaaggcaggctgtgagg
gagacctggggcagcccagttgctgggacccggttactcttcctgctggggtccccacta
ggaatgggggggcctgacctaacatcactggtgacgtgggagagccggcgctatggtgac
ctactgctctgggacttcctggatgttccctacaaccggacactgaaagacctgctgctg
ctgacctggctgagccaccactgccccaaggtcagtttcgtcctgcaggttcaggacaat
gcctttgtccacatcccagccctgctggagcacctgcaggctctgccacctacctgggcc
cgcagcctctacctgggtgaggtcttcacccaggccaaaccacttcgcaagcccggagga
cccttctatgtgccgaagaccttctttgaaggtgactacccagcctatgcaagtgggggt
ggctacgtcatctcggggcgcctggctccctggctgctgcaggcagcagcccgagtagcg
cccttcccctttgatgatgtctacactggtttctgcttccgtgccctgggcttagcgccc
cgtgcccatccaggcttcctcacagcctggccagcagagcgtaccagggacccctgcgct
gtacgaggcctgctgctggtgcatccagtcagcccccaggacaccatttggctctggaga
catctgtgggttccagagctccggtgctga

DBGET integrated database retrieval system