KEGG   Rattus norvegicus (rat): 308444Help
Entry
308444            CDS       T01003                                 

Gene name
Axl
Definition
(RefSeq) Axl receptor tyrosine kinase
  KO
K05115  AXL receptor tyrosine kinase [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    308444 (Axl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    308444 (Axl)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     308444 (Axl)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  AXL family
   308444 (Axl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase fn3 Ig_3 Ig_2 ig I-set V-set DUF4381 Ig_6 C1-set
Motif
Other DBs
NCBI-GeneID: 308444
NCBI-ProteinID: NP_001013165
RGD: 620028
Ensembl: ENSRNOG00000020716
UniProt: Q8VI99
Position
1q21
AA seq 879 aa AA seqDB search
MGRVPLAWCVALCCWGCAAPKDTQTEADSPFVGNPGNITGARGLTGTLRCELQVQGEPPE
VMWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTF
VSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVAGY
SFQHSLQAPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHNLHVVSRHPTELEVAWI
PTLSGIYPLTHCTLQAVLSNDGVGVWLGKSDPPEEPLTVQVSVPPHQLRLEKLLPHTPYH
IRVSCTSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQALVRWQEPREPLQGTLLG
YRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVAAYTSAGDGPWSLPVPLEPW
RPVSEPPPPAFSWPWWYVLLGALVAAACVLILTLFLVHRRKKETRYGEVFEPTVERGELV
VRYRARKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQL
NQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPE
PVVILPFMKHGDLHSFLLYSRLGDQPVFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAA
RNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSF
GVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPLDCLDGLYALMSRCWELNPRDRPS
FAELREDLENTLKALPPAQEPDEILYVNMDEGGSHLEPRGAAGGADPPTQPDPKDYCSCL
TAADVHSAGRYVLCPSTAPGPTLSADRGCPAPPGQEDGA
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgggcagggtcccgctggcctggtgcgtggcgctgtgctgctgggggtgtgcagcccct
aaggacacacagaccgaggctgacagcccattcgtggggaacccagggaatatcacgggt
gccagaggactcacggggacccttcggtgtgagctccaggttcagggggagccccctgag
gtgatgtggcttcgagatggacagatcctagaactggctgataacacccagacccaggtg
cctctgggcgaagactggcaagatgaatggaaagtcgtcagtcagctcagaatctcagcc
ctgcaactttcagatgcaggagagtaccagtgtatggtgcacctggaaggacggaccttt
gtgtctcagccgggctttgtaggactggaaggtctcccgtacttcctggaggaacctgaa
gacaaagctgtgcctgccaacacccccttcaacctaagctgccaggcccagggacccccg
gaacccgtgaccctgctctggcttcaagatgctgtccctctggccccagtcgcaggatac
agctttcagcacagtttgcaagctccaggcctgaacaagacatcttctttctcatgtgaa
gcccacaatgccaagggagtcaccacctcccgcacagctaccatcacagtgctcccacag
agacctcacaatctccacgtggtttccagacatcccacggagctagaggtagcttggatc
cctaccctgagtggcatctacccgctcacccactgcaccctgcaggctgtgctgtcaaac
gatggggtgggcgtctggctgggaaagtcagatcctcctgaagaacccctcaccgtgcaa
gtatcagtgcccccccaccagcttcggctggaaaagctccttcctcacaccccatatcac
atccgggtatcctgcactagcagccagggcccctcaccttggacccactggcttcctgtg
gagaccacggagggagtgcccttgggtccccctgagaacgttagcgccatgcggaatggg
agccaggccctcgtgcgttggcaggagccaagggagcccttgcagggcaccctgttaggg
taccggctggcatatcgaggccaggacacccccgaggtacttatggatatagggctaact
cgagaggtgaccttggaacttcggggggacaggcctgtggctaacctgactgtgtctgtg
gcagcctatacctcagctggggatgggccctggagccttcctgtgcccctagagccctgg
cgcccagtgagtgaacccccacctcccgccttctcgtggccttggtggtatgtactgctg
ggagcacttgtggccgccgcctgtgtccttatcttgaccctgttccttgtccatcggagg
aagaaggagacgagatatggggaggtgttcgagccaactgtggaaaggggtgaactggta
gtcaggtaccgtgcccgaaagtcctacagtcgccggaccacggaagccaccttgaacagt
ctgggcatcagcgaagagctgaaggagaaactacgagacgtcatggtagatcggcataag
gtggccttggggaagaccctgggagagggagaatttggtgctgtgatggagggccagctc
aaccaggatgactccatcctcaaggtcgctgtgaagaccatgaaaattgccatctgcaca
agatcagagctggaggatttcctgagtgaagctgtctgcatgaaggaatttgaccacccc
aacgtcatgaggctcattggcgtctgtttccagggttctgaccgagagggtttcccagaa
ccggtggtcatcttgcctttcatgaaacatggagacctccacagtttcctcctgtactcg
cggctcggggaccagccagtgttcctgcccactcagatgctagtgaagtttatggccgac
attgccagtggcatggagtacctcagtaccaagagattcatacaccgggacctagctgcc
aggaactgcatgctgaatgagaacatgtccgtgtgcgtggcagacttcgggctctccaag
aagatctacaatggggattactaccgccaagggcgcattgccaagatgccagtcaagtgg
attgctatcgagagtctggcagatcgagtctacaccagcaagagtgacgtgtggtccttc
ggtgtgacaatgtgggagatcgccacccgaggccaaactccctatccaggggtggagaac
agtgagatttacgactacctacgtcaaggaaatcgcctgaaacagcctctggactgtctg
gatggcctctatgccctgatgtcccggtgctgggagctgaaccctcgagaccggccaagt
tttgcagagctccgggaagacttggagaacacattgaaggctctaccccctgctcaggag
cctgatgaaatcctctatgtcaacatggatgagggcggaagtcaccttgaaccccgtggg
gctgctggaggagctgaccccccaacccaacctgatcctaaggattactgtagctgtctc
actgcagctgacgtccactcagctggacgctatgtcctttgtccttctacagccccagga
cccactctgtctgctgacagaggctgcccagcacctccagggcaggaggacggagcctga

DBGET integrated database retrieval system