KEGG   Rattus norvegicus (rat): 308449
Entry
308449            CDS       T01003                                 

Gene name
Hipk4
Definition
(RefSeq) homeodomain interacting protein kinase 4
  KO
K08826  homeodomain interacting protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    308449 (Hipk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    308449 (Hipk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     308449 (Hipk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   308449 (Hipk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo Pox_ser-thr_kin RIO1 HSM3_N
Other DBs
NCBI-GeneID: 308449
NCBI-ProteinID: NP_001019947
RGD: 1307541
Ensembl: ENSRNOG00000020835
UniProt: Q4V793
Position
1q21
AA seq 616 aa
MATIQSETDCYDIIEVLGKGTFGEVAKGWRRSTGEMVAIKILKNDAYRSRIIKNELKLLR
CVRGLDPDEAHVIRFLEFFHDALKFYLVFELLEQNLFEFQKENNFAPLPARHIRTVTLQV
LRALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSASIFSEVRYVKEPYIQSRF
YRAPEILLGLPFCEKVDVWSLGCVMAELHLGWPLYPGNNEYDQVRYICETQGLPKPHLLH
AARKAHHFFKRNPHPDATNPWQLKSSADYLAETKVRPLERRKYMLKSLDQIETVNGGGAV
NRLSFPDREALAEHADLKSMVELIKRMLTWESHERISPSAALRHPFVSMQQLRSAHEATR
YYQLSLRGCRLSLQVDGKPPPPVIANAEDGPPYYRLAEEEETAGLGGVTGSGSFFREDKA
PGMQRAIDQLDDLSLQEARRGLWSDTRADMVSDMLAPLKVATTSHRVPDSGPEPILAFYG
SRLTGRHKARKAPAGSKSDSNFSNLIRLSQASPEDAGSCRGSGWEEGEGHTTSTEPSAIP
QREGDGPSIKDRPMDAERSGPELFDPSGCPGEWLNEPEWTLEGIRGSRAQGLPARHPHPH
GPPRTTSFLQHVGGHH
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggccaccatccagtcagagactgactgttacgacatcattgaagtcctgggcaagggc
acttttggagaggtggccaagggctggcgtcggagtacaggagaaatggtggccatcaag
atcttgaagaacgacgcgtaccgaagccgtatcatcaagaatgagttgaagctgctgcgc
tgtgtacgaggcctggaccccgacgaggcccacgtcatccgcttccttgaattcttccat
gatgccctcaagttctacctggtctttgagctattggagcaaaacctctttgagttccag
aaagagaacaacttcgcacccctccctgccaggcacatccgaactgtcacactgcaggtc
ctaagagcgctggcccggctcaaggagttggctatcatccatgctgacctcaagccagaa
aacattatgttggtagatcagacccgctgccccttcagggtaaaggtgatcgactttggc
tcggccagcatattcagtgaggtgcgctatgtgaaggagccttacatccagtcccgcttc
tacagggccccagagatcctgttggggttgccgttctgcgagaaggtggacgtgtggtct
ctgggctgtgtcatggctgagttacacctgggctggcctctctacccaggcaacaatgag
tatgaccaggtgcgctacatctgtgagacccagggcttacccaagccccatctgctgcat
gcggcccgcaaggctcaccacttcttcaagcgtaacccccaccccgatgccaccaacccc
tggcagctcaagtcctctgctgactacctagctgagaccaaggtacgcccactggagcgc
cgcaagtacatgctcaaatccttggaccaaattgagacggtgaatggtggcggcgctgtg
aatcggttgagttttccagaccgggaggcactggcggaacacgcggacctcaagagcatg
gtggagctgatcaaacgcatgctgacatgggagtctcacgagcgcatcagtcccagcgcg
gccctgcgccaccccttcgtgtccatgcagcagctgcgtagtgcccacgaggccacccgc
tactaccagctgtccctccgaggctgtcggctgtccctgcaggtggacggcaagccaccc
ccacctgtcatagccaacgcagaggacgggcctccctactaccgcctggctgaggaggag
gagactgcaggcctgggtggtgtgaccggcagtgggtccttcttcagggaggacaaggct
cccggaatgcagagagccatcgaccagctcgatgacctgagtctgcaggaggcccgccgg
gggctgtggagcgacacgcgggccgacatggtctctgacatgctggctccactcaaagta
gccactaccagccatcgagtccccgactcgggcccggagcctatcctggccttctacggc
agccgcttgactggccgccataaggcccgcaaggccccagcaggctccaaatccgactcc
aacttcagtaacctcatccggctgagccaggcctcacctgaggatgcggggtcctgtagg
ggcagtggttgggaagaaggagaaggccacacgacttccacagagccgtctgccatccca
caacgggaaggagatggacccagcatcaaagacaggcccatggatgctgagaggtcaggc
cctgagctctttgatcccagcggctgtcctggagagtggctaaatgaaccagaatggacc
ctagagggcatccgggggtctcgagctcaagggcttccagctcgccatccccacccacac
gggccgcccaggaccaccagctttctgcagcatgttggagggcaccactga

DBGET integrated database retrieval system