KEGG   Rattus norvegicus (rat): 308449
Entry
308449            CDS       T01003                                 

Gene name
Hipk4
Definition
(RefSeq) homeodomain-interacting protein kinase 4
  KO
K08826  homeodomain interacting protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    308449 (Hipk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    308449 (Hipk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     308449 (Hipk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   308449 (Hipk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like TCAD9 Kdo Pox_ser-thr_kin RIO1
Other DBs
NCBI-GeneID: 308449
NCBI-ProteinID: NP_001019947
RGD: 1307541
Ensembl: ENSRNOG00000020835
UniProt: Q4V793
Position
1
AA seq 616 aa
MATIQSETDCYDIIEVLGKGTFGEVAKGWRRSTGEMVAIKILKNDAYRSRIIKNELKLLR
CVRGLDPDEAHVIRFLEFFHDALKFYLVFELLEQNLFEFQKENNFAPLPARHIRTVTLQV
LRALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSASIFSEVRYVKEPYIQSRF
YRAPEILLGLPFCEKVDVWSLGCVMAELHLGWPLYPGNNEYDQVRYICETQGLPKPHLLH
AARKAHHFFKRNPHPDATNPWQLKSSADYLAETKVRPLERRKYMLKSLDQIETVNGGGAV
NRLSFPDREALAEHADLKSMVELIKRMLTWESHERISPSAALRHPFVSMQQLRSAHEATR
YYQLSLRGCRLSLQVDGKPPPPVIANAEDGPPYYRLAEEEETAGLGGVTGSGSFFREDKA
PGMQRAIDQLDDLSLQEARRGLWSDTRADMVSDMLAPLKVATTSHRVPDSGPEPILAFYG
SRLTGRHKARKAPAGSKSDSNFSNLIRLSQASPEDAGSCRGSGWEEGEGHTTSTEPSAIP
QREGDGPSIKDRPMDAERSGPELFDPSGCPGEWLNEPEWTLEGIRGSRAQGLPARHPHPH
GPPRTTSFLQHVGGHH
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggccaccatccagtcagagactgactgttacgacatcattgaagtcctgggcaagggc
acttttggagaggtggccaagggctggcgtcggagtacaggagaaatggtggccatcaag
atcttgaagaacgacgcgtaccgaagccgtatcatcaagaatgagttgaagctgctgcgc
tgtgtacgaggcctggaccccgacgaggcccacgtcatccgcttccttgaattcttccat
gatgccctcaagttctacctggtctttgagctattggagcaaaacctctttgagttccag
aaagagaacaacttcgcacccctccctgccaggcacatccgaactgtcacactgcaggtc
ctaagagcgctggcccggctcaaggagttggctatcatccatgctgacctcaagccagaa
aacattatgttggtagatcagacccgctgccccttcagggtaaaggtgatcgactttggc
tcggccagcatattcagtgaggtgcgctatgtgaaggagccttacatccagtcccgcttc
tacagggccccagagatcctgttggggttgccgttctgcgagaaggtggacgtgtggtct
ctgggctgtgtcatggctgagttacacctgggctggcctctctacccaggcaacaatgag
tatgaccaggtgcgctacatctgtgagacccagggcttacccaagccccatctgctgcat
gcggcccgcaaggctcaccacttcttcaagcgtaacccccaccccgatgccaccaacccc
tggcagctcaagtcctctgctgactacctagctgagaccaaggtacgcccactggagcgc
cgcaagtacatgctcaaatccttggaccaaattgagacggtgaatggtggcggcgctgtg
aatcggttgagttttccagaccgggaggcactggcggaacacgcggacctcaagagcatg
gtggagctgatcaaacgcatgctgacatgggagtctcacgagcgcatcagtcccagcgcg
gccctgcgccaccccttcgtgtccatgcagcagctgcgtagtgcccacgaggccacccgc
tactaccagctgtccctccgaggctgtcggctgtccctgcaggtggacggcaagccaccc
ccacctgtcatagccaacgcagaggacgggcctccctactaccgcctggctgaggaggag
gagactgcaggcctgggtggtgtgaccggcagtgggtccttcttcagggaggacaaggct
cccggaatgcagagagccatcgaccagctcgatgacctgagtctgcaggaggcccgccgg
gggctgtggagcgacacgcgggccgacatggtctctgacatgctggctccactcaaagta
gccactaccagccatcgagtccccgactcgggcccggagcctatcctggccttctacggc
agccgcttgactggccgccataaggcccgcaaggccccagcaggctccaaatccgactcc
aacttcagtaacctcatccggctgagccaggcctcacctgaggatgcggggtcctgtagg
ggcagtggttgggaagaaggagaaggccacacgacttccacagagccgtctgccatccca
caacgggaaggagatggacccagcatcaaagacaggcccatggatgctgagaggtcaggc
cctgagctctttgatcccagcggctgtcctggagagtggctaaatgaaccagaatggacc
ctagagggcatccgggggtctcgagctcaagggcttccagctcgccatccccacccacac
gggccgcccaggaccaccagctttctgcagcatgttggagggcaccactga

KEGG   Rattus norvegicus (rat): 362342
Entry
362342            CDS       T01003                                 

Gene name
Hipk2
Definition
(RefSeq) homeodomain-interacting protein kinase 2
  KO
K08826  homeodomain interacting protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    362342 (Hipk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    362342 (Hipk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     362342 (Hipk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   362342 (Hipk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Pkinase_fungal TCAD9 APH Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 362342
NCBI-ProteinID: NP_001102092
RGD: 1309349
Ensembl: ENSRNOG00000007034
UniProt: D3ZN85
Position
4
AA seq 1195 aa
MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKVEPSSNWDMTGYGSHSKVYSQSKNIPPS
QPASTTVSTSLPIPNPSLPYEQTIIFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTV
SLLDTYQKCGLKRKSEEIENTSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNS
EGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQG
QIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKY
IRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSASHVSKAVCST
YLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLP
AEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVN
MTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTH
VKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQAPTSTS
ATLSLANPEVSILNYQSTLYQPSAASMAAVAQRSMPLQTGTAQICARPDPFQQALIVCPP
GFQGLQASPSKHAGYSVRMENAVPIVTQAPGAQPLQIQPGLLAQAWPGGAQQILLPPAWQ
QLTGVATHTSVQHAAVIPETMAGTQQLADWRNTHAHGSHYNPIMQQPALLTGHVTLPAAQ
PLNVGVAHVMRQQPTSTTSSRKSKQHQSSARNVSTCEVTSSQAISSPQRSKRVKENTPPR
CAMVHSSPACSTSLTCGWGDGASSTTRDRQRQTIVIPDTPSPTVSVITISSDTDEEEEQK
HAPTSTVSKQRKNVISCVTVHDSPYSDSSSNTSPYSVQQRTGHNGTNTLDTKGGLENHCT
GNPRTIIVPPLKTQASEVLVECDSLGPAISTGHHSSSFKSKSSSTVTSTSGHSSGSSSGA
IAYRQQRPGPHFQQQQPLNLSQAQQHMAADRTGSHRRQQAYITPTMAQAPYTFPHSSPSH
GTVHPHLAAAAHLPAQPHLYTYTAPTALGSTSTVAHLVASQGSARHTVQHTAYPASIVHQ
VPVSMGPRVLPSPTIHPSQYPAQFAHQTYISASPASTVYTGYPLSPAKVNQYPYI
NT seq 3588 nt   +upstreamnt  +downstreamnt
atggcccccgtgtacgaaggtatggcctcacatgtgcaagttttctcccctcacaccctt
caatcaagtgccttctgtagtgtgaagaaactaaaagtagagccaagttccaactgggac
atgactgggtacggctcccacagcaaagtgtacagccagagcaagaacataccaccttct
cagccagcctccacaaccgtcagcacctccttgccaatcccaaacccaagcctaccttac
gagcagaccatcatcttcccaggaagtactggacacatagttgtaacatcagcaagtagc
acttctgtcaccgggcaagtcctcggtggaccacataacctaatgcgtcgaagcactgtg
agcctccttgacacctaccaaaaatgtggactcaagcgcaagagtgaggagattgagaac
acaagcagcgtgcagatcattgaggagcatccacccatgattcagaataatgccagcggg
gccactgtcgccactgccaccacatccactgccacctccaaaaacagtggctccaacagt
gaaggtgactatcagctggtgcagcatgaagtgctgtgctctatgacaaacacctatgag
gttttagagttcttggggcgagggacatttgggcaagtggtcaagtgctggaaacggggc
accaatgaaattgtggccattaagatcctaaagaaccacccatcctatgcccggcaaggc
cagattgaagtgagcatcctggcccggctgagcacggagagcgctgatgactacaatttt
gtgcgggcctatgagtgcttccagcacaagaatcacacatgcttagtctttgagatgttg
gagcagaacctctatgactttctgaaacagaacaagtttagtcccttgcccctcaagtat
attcgcccagtcctccagcaggtagccacagccctgatgaaactcaaaagcctgggtctt
atccatgctgacctcaaaccagaaaacatcatgctggtggatccatccagacaaccatac
cgagtgaaggtcattgactttggttcagctagtcatgtgtccaaagctgtctgttctacg
tacttgcaatccagatactacagggcccctgaaatcatccttggtttgccattctgtgag
gcaattgacatgtggtccctgggttgtgtcattgctgagctgttcctgggctggccatta
tacccaggtgcttctgagtatgatcagattcggtatatttcacaaacacagggtttacca
gctgaatatttattaagtgcagggacaaagacaactaggtttttcaaccgtgacacagac
tcaccgtatcctttgtggaggctaaagacaccagatgaccatgaagcagagacggggatt
aaatcaaaagaagcaagaaagtacattttcaactgtttggatgacatggcccaggtgaac
atgacaacagatttggaagggagtgacatgttagtagagaaggcagaccggcgggagttc
attgacctgttaaagaagatgctgaccatagatgctgataagaggatcactcccattgaa
actctgaaccacccctttgtcaccatgacgcacctactggattttcctcatagtactcat
gtcaaatcttgtttccaaaacatggagatttgcaagcgccgggtgaatatgtatgacaca
gtgaaccagagcaaaacacctttcatcacacatgtggcccccagcacatctaccaacttg
accatgacctttaacaaccagctgaccactgtccacaaccaggctcccacctccaccagt
gccactctttccttagccaatcccgaagtctccatactaaactaccaatctacactctac
cagccctcagcggcatccatggccgcagtggcccagcggagcatgcccctgcagacggga
acagcccaaatttgtgcccggcctgaccctttccagcaagctctcatcgtgtgtccccct
ggcttccaaggcctgcaggcctctccctccaagcacgctggctactcagtgcggatggaa
aatgctgttcccatcgtcactcaggctccgggcgctcagcctcttcagatccagccaggt
ctgcttgctcaggcctggccaggtggggcccaacagatcctccttcctccagcatggcag
cagctcactggcgtggctacccacacatccgtacagcacgcagctgtgattcccgagacc
atggcaggcactcagcaactggctgactggagaaacacacatgctcacggaagccattac
aatcccatcatgcagcagcctgcactcttgactggtcatgtgacccttccagctgcccag
cccttaaatgtgggtgtagcccacgtgatgagacagcaaccaaccagcaccacctcctcc
aggaagagtaagcagcaccaatcatcagcgagaaatgtctccacctgtgaagtgacctct
tcccaggctatcagctcccctcagcgatccaagcgtgtcaaggagaacactcccccgagg
tgtgcaatggtacacagcagcccagcttgcagcacctcactcacctgtgggtggggtgac
ggggcctccagcaccacccgggaccgacagcggcagaccattgtcatccccgacaccccg
agccccacagtcagtgtcatcaccatcagcagcgacacagatgaggaggaggaacagaag
cacgcccccaccagcacagtctccaagcaaagaaaaaatgtcatcagctgtgtcacagtc
catgattctccctactctgactcctccagcaacaccagcccctactcggtgcagcagcgc
acagggcacaacggcaccaacaccttggacaccaaggggggcctagagaaccactgcacc
ggcaacccccgcaccatcatcgtacccccactgaagacgcaggccagtgaagtgttggta
gaatgtgacagcctagggccagcaatcagtaccggtcaccattcatcctccttcaagtcc
aagtcctccagcaccgtgacctccaccagtggccactcttcagggagctcgtcaggagcc
atcgcctaccgtcaacagcggccaggcccccacttccagcagcagcagcccctcaatctc
agccaggctcagcagcacatggctgcagaccgcactgggagtcaccgtcggcagcaggcc
tacatcactcctaccatggctcaggctccgtacaccttcccgcacagcagccccagccat
ggcactgttcacccccacctggctgcggctgcccacctccctgcccagcctcacctctac
acctacacagcgcccacagccctaggctccaccagcactgtagcccacctggtggcatcc
caaggctcagcacgacacaccgtgcagcacactgcctatccggccagcatcgtccaccag
gtccccgtgagcatggggccccgggtcctgccctcgcccaccattcaccccagtcagtat
ccggcccagtttgcccaccagacctatatcagcgcctcgccagcctccaccgtctacact
ggatatccactgagtcctgccaaggtcaaccaatacccttacatataa

KEGG   Rattus norvegicus (rat): 365895
Entry
365895            CDS       T01003                                 

Gene name
Hipk1
Definition
(RefSeq) homeodomain-interacting protein kinase 1
  KO
K08826  homeodomain interacting protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    365895 (Hipk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    365895 (Hipk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     365895 (Hipk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   365895 (Hipk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo TCAD9 Pkinase_fungal APH Pox_ser-thr_kin GP24_25
Other DBs
NCBI-GeneID: 365895
NCBI-ProteinID: NP_001094456
RGD: 1304941
Ensembl: ENSRNOG00000019333
UniProt: F1M8I6
Position
2
AA seq 1211 aa
MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQASSSH
QVANFNIPAYDQGLLLQAPAVEHIVVTAADSSGSAATATFQSSQTLTHRSNVSLLEPYQK
CGLKRKSEEVDSNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQH
EILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSR
LSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVA
TALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRA
PEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGT
KTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTD
MLAEKADRREYIDLLKKMLTIDADKRVTPLKTLNHQFVTMTHLLDFPHSNHVKSCFQNME
ICKRRVHMYDTVSQIKSPFTTHVAPSTSTNLTMSFSNQLSTVHNQASVLASSSTAAAATL
SLANSDVSLLNYQSALYPPSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTFIVCPPAFQ
TGLQATTKHSGFPVRMDNAVPLVPQAPAAQPLQIQSGVLTQGSCTPLMVATLHPQVATIT
PQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSAWQQLPGVALHNSVQPTAVI
PEAMGSSQQLADWRNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSS
LPSRKNKQSAPVSSTSSLEVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPS
PPVSVITIRSDTDEEEDNKFKPSSSSLKARSNVISYVTVNDSPDSDSSLSSPYPTDTLSA
LRGNSGTLLEGPGRTAADGIGTRTIIVPPLKTQLGDCTGATQASGLLSSSKTKPVASVSG
QSSGCCITPTGYRAQRGGASAVQPLNLSQNQQSSSASTSQERSSNPAPRRQQAFVAPLSQ
APYAFQHGSPLHSTGHPHLAPAPAHLPSQPHLYTYAAPTSAAALGSTSSIAHLFSPQGSS
RHAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRGSTIYTGYPL
SPTKISQYSYL
NT seq 3636 nt   +upstreamnt  +downstreamnt
atggcatcacagctgcaggtgttttcccctccatcagtgtcgtcgagtgccttctgcagt
gcgaagaaactgaaaatagagccctctggctgggatgtttcaggacagagcagcaacgac
aaatattatacccacagcaaaaccctcccagctacacaagggcaagccagctcctctcac
caggtagcaaatttcaatattcctgcttacgaccagggcctcctcctccaggctcctgca
gtggagcatattgtggtaacagctgctgacagctcaggcagtgccgccacggcaaccttc
caaagcagccagaccctgactcacaggagcaacgtttctttgcttgagccatatcaaaaa
tgtggattgaaaagaaaaagtgaggaagtcgacagcaacggtagcgtgcagatcatagaa
gaacatccccctctcatgctgcaaaacagaactgtggtgggtgctgctgccacgaccacc
actgtgaccacgaagagtagcagttctagcggagaaggggattaccagctggtccagcat
gagatcctgtgctctatgaccaatagttatgaagtcttggagttcctaggccgagggaca
tttggacaggtggcaaagtgctggaagcggagcaccaaggaaattgtggccattaagatc
ttgaagaaccacccctcctatgccagacaaggacagatcgaagtgagcatcctttctcgc
ctaagcagtgagaatgctgatgagtataattttgtccgatcttatgagtgttttcagcac
aagaatcatacctgccttgtgtttgagatgttggagcagaatttgtatgattttctaaag
cagaacaagtttagcccactgccactcaagtacataagaccaatcttgcagcaggtggcc
acagccctgatgaagctgaagagtcttggtctgattcatgctgacctcaaacctgagaac
atcatgctggttgatccagttcgccaaccctaccgagtgaaggtcattgactttggttct
gcgagtcatgtttccaaagccgtatgttcaacctacctgcaatcacgctactacagagct
cctgaaattatccttgggttgccattctgtgaggctattgacatgtggtcgctgggctgt
gtaatagctgagctgttcctgggctggcctctttatcctggtgcttcagaatacgatcag
attcgttatatctcacaaacacaaggcctgccagctgaatatctcctcagtgccggaaca
aaaacaactaggtttttcaacagagatcctaatttggggtacccactgtggaggcttaag
acaccagaagaacatgaattagagactggaataaagtcaaaagaagctcggaagtacatt
tttaactgtttagatgacatggctcaggtaaatatgtctacagacttagagggaacagac
atgttggcagaaaaggcagaccggagagaatacattgatctcctaaagaaaatgctgacg
attgatgcagacaagagagtcacgcctctgaaaactcttaaccaccagttcgtgacaatg
acccaccttctggactttccacacagtaaccatgttaagtcttgtttccagaacatggag
atctgcaagcggagggttcacatgtatgacacagtgagtcagatcaagagtcccttcact
acccatgtggctccaagtacaagcacaaatctaaccatgagcttcagcaaccagctcagc
acagtgcacaaccaggccagtgttttagcctccagctctactgcagcagctgctactctt
tctctggctaactcagacgtctcgctgctaaactaccagtcagctttgtaccctccgtcc
gcagcgcccgttcctggagttgcccagcagggtgtttccttacagcctggaaccacccag
atctgcacccagacggacccattccagcaaacattcatagtgtgtccacctgcctttcag
actgggctacaagcaacaacaaagcattctggattccctgtgaggatggataatgctgtg
ccacttgtcccccaggcgcccgcagcccagccactgcagatacagtcaggagtgctcaca
cagggaagctgtacaccactaatggtagcaactctccaccctcaagtagccaccatcaca
ccgcagtatgcggtgccctttaccctgagctgcgcagccggccggccggcgctggttgaa
cagactgctgctgtactgcaagcttggcctggaggaacccaacagattctcctgccttca
gcatggcagcagctgcctggggtcgctctacacaactctgtccagcctactgcagtgatt
ccagaggccatggggagcagccagcagctagccgactggaggaatgcccactctcatggc
aaccagtacagcactatcatgcaacagccatctttgctgactaaccatgtgacgttggcc
actgcgcagcctctgaatgttggtgttgctcatgttgtcagacaacagcagtctagttcc
ctcccttcaaggaagaataaacagtctgctccagtctcatccacatcttctctggaagtt
ctgccttcccaagtttattctctggttggaagtagtcctcttcgtaccacatcttcttat
aattccctagtccctgtccaagaccagcatcagccaatcatcattccagacactcccagc
cctcctgtgagtgtcatcactatccgtagtgacaccgatgaagaagaggacaacaaattc
aagcccagcagctcgagcctgaaggcgaggtctaatgtcatcagttatgtgactgtcaat
gattctccagactctgactcctccctgagcagcccataccccacagacactctgagtgct
ctgcggggcaacagcgggacacttctggagggacctggcagaactgcagcagatggcatt
ggcacccgtacgatcattgtgcctcctttaaaaacacagcttggcgactgtactggagca
acacaggcctcaggtctccttagcagtagtaagaccaagccagtggcctcagtgagtggg
cagtcatctggatgctgtatcactcccacagggtaccgagctcaacgagggggagccagc
gcggtgcagccactcaaccttagccagaaccagcagtcatcgtcagcttcaacctcgcag
gaaagaagcagcaaccctgctccccgcagacagcaggcatttgtggccccgctctcccaa
gccccctacgccttccagcatggcagcccactgcactcgacggggcacccacatttggcc
ccagcccctgctcacctgccaagccagcctcacctgtatacgtacgctgcccccacttct
gctgctgcattgggttccaccagttccattgctcatcttttctccccccagggttcctca
aggcatgctgcagcttataccacccaccccagcactctggtgcatcaggttcctgtcagt
gttgggcctagcctcctcacctctgccagtgtggcccctgctcagtaccaacaccagttt
gccactcagtcctatattgggtcttcccgaggctcaacaatttacactggatacccgctg
agtcctaccaagatcagtcagtattcttatttgtag

KEGG   Rattus norvegicus (rat): 83617
Entry
83617             CDS       T01003                                 

Gene name
Hipk3
Definition
(RefSeq) homeodomain-interacting protein kinase 3
  KO
K08826  homeodomain interacting protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    83617 (Hipk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    83617 (Hipk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     83617 (Hipk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   83617 (Hipk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Pkinase_fungal TCAD9 APH RIO1
Other DBs
NCBI-GeneID: 83617
NCBI-ProteinID: NP_113975
RGD: 619884
Ensembl: ENSRNOG00000011358
UniProt: O88850
Position
3
AA seq 1191 aa
MASQVLVYPPYVYQTQSSAFCSVKKLKVEPSGCVFQERACPQIHVNGRHFGNPLPSTKGS
AFQTKIPFSKPRGHSFSLQAGAIVVKDTAGATKVIAAQAQQAGVEAPRAVVWRNRLHFLG
GPQRCGLKRKSEELDNHSGAMQIVDELSILPAMLQTNMGNPVTVVTATTGSKQNCTSGEG
DYQLVQHEVLCSVKNTYEVLDFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQI
EVSILARLSTENADEYNFVRAYECFQHRNHTCLVFEMLEQNLYDFLKQNKFSPLPLKVIR
PVLQQVATALKKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKTVCSTYL
QSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGALEYDQIRYISQTQGLPGE
QLLNVGTKSTRFFCRETDMSHSGWRLKTLEEHEAETGMKSKEARKYIFNSLDDIVHVNTV
MDLEGSDLLAEKADRREFVSLLKKMLLIDADLRITPIETLNHPFVSMKHLLDFPHSSHVK
SCFHIMDICKSPSSCETNNHSKMSLLRPVASNGTAALAANFTKVGTLRSQALTTSAHSVV
HHGIPLQAGTAQFGCGDAFHQTLIICPPAIQGIPAAHGKPTSYSIRVDNTVPLVTQAPAV
QPLQIRPGVLSQTWSGRTQQMLIPAWQQVTPMAPAAATLTSEGMAGSQRLGDWGKMIPHS
NHYNSVMPPPLLTNQITLSAPQPISVGIAHVVWPQPATTKKNKLCQNRSNSLQNTNVPHS
AFISPKIISGKEVEEVSCVETQDNHTSEGEARTCHEASVRQDSSVSDKQRQTIIIADSPS
PAVSVITISSDTDDEETSPRPSLRECKGSLDCEACQSTLNIDRMCSLSSPDSTLSTSSSG
QSSPSPCKRPNSMSDDEQESGCETVDGSPTSDSSGHDSPFAESSFVEDTPQNPELGTCAG
TEAKPALSTAVEPPVGTERGLNVDAHMANTDSTCQPLTKGQPAPGKLNQPSASAARQQKP
TSAFQQQHLNLSQVQHFGTGHQEWNGNFGHRRQQAYIPTSVTSNPFTLSHGSPNHTAVHA
HLAGSAHLGGQPTLLPYPPSTALSSAAPVAHLLASPCTSRPMLQHPTYNISHPSGIVHQV
PVGINPRLLPSPTIHQTQYKPIFPPHSYIAASPAYTGFPLSPTKLSQYPYM
NT seq 3576 nt   +upstreamnt  +downstreamnt
atggcctcacaagtcttggtctacccaccatatgtttatcaaactcagtcaagtgccttt
tgtagtgtgaagaaactgaaagtagagcccagcggttgtgttttccaggaaagagcctgc
cctcagatccatgtgaatggtagacactttggaaatcctcttccttccacgaagggtagt
gctttccagacaaagataccattctctaaacctcgaggacacagcttttcactgcaggca
ggggccattgttgtcaaagacactgccggtgctacaaaggtcatagcagctcaggcgcag
caggctggagtggaggcacctcgggccgtggtgtggagaaacaggctacatttcctagga
ggtccccagcgatgcgggttaaagcgcaagagtgaggagttggataatcacagcggcgcg
atgcagattgtcgatgaactgtccatacttcctgcaatgttgcaaaccaacatgggaaac
ccagtgacagttgtgacagcgaccacaggatcgaaacagaactgtaccagtggggaaggt
gactatcagttagtgcagcacgaagtcttgtgctctgtgaaaaacacatatgaagtcctg
gattttcttggtcgtggcactttcggccaggttgttaaatgctggaagagagggacaaat
gaaattgtagccattaaaattttgaagaatcacccttcgtatgcacgtcaagggcagata
gaagtgagcatcttagcaaggctcagtactgagaacgctgatgagtataactttgtgcga
gcctatgagtgcttccagcaccgcaaccatacctgcctggtctttgagatgctggagcag
aacctgtatgacttcctgaaacagaataaattcagtcccttgcccctaaaggtgatccgg
cccgttcttcagcaagtggccactgcactgaagaaattaaaaagtcttggtttaattcat
gctgaccttaaaccagagaatattatgttggtggatcctgttcgacagccatacagggtt
aaagtgatagactttggatcggccagtcatgtatcaaagactgtttgctcaacgtatcta
caatctcggtactatagagctccagagattatattggggttgccgttttgtgaagccata
gacatgtggtcactgggatgcgtgattgcagagttattccttggatggccactctacccg
ggagccttggagtatgaccagattcgatacatttctcagactcaaggtttaccaggagaa
caattgttgaatgtgggtacaaaatccacaagatttttttgcagagaaacagatatgtct
cattctggttggaggttaaagacactggaagagcatgaagcagagacaggaatgaagtct
aaagaggccagaaagtacatattcaacagtctggacgatatagtgcatgtgaacacagtg
atggacttggaaggaagtgatctcttggctgagaaagctgatagaagagaatttgttagt
ctgttgaagaaaatgttgctgattgatgcagatttaagaattactccgatcgagactctg
aaccacccattcgttagtatgaagcacctactagattttcctcacagcagccatgtaaag
tcctgttttcatatcatggatatttgtaagtctccgagttcatgtgaaacaaacaaccac
agtaaaatgtcactcttacgaccagttgcatccaatggcactgctgctctagcggcaaac
tttactaaagtcggaacattaagaagtcaggcgttgaccacatctgctcactcggtcgtg
caccatggtatacctctgcaggcggggaccgcacagttcggttgtggtgatgcttttcat
cagaccctgattatctgtcccccagctattcaaggtattcccgcagcacatggtaagccc
accagttattccataagggtggacaacacagttccgcttgtgactcaggccccagctgta
cagcctctgcagatccgaccaggagtcctttcacagacatggtctggtcgaacacagcag
atgctaatacctgcctggcagcaggtaacacccatggctcctgctgctgcaacactaact
tctgaaggcatggctggttcacagaggcttggagactgggggaaaatgattccacacagc
aatcattataactccgtgatgccgccacctcttctgaccaaccagataacattgtcggcc
cctcagcctatcagcgtaggcatcgcacatgttgtctggcctcagcctgccactaccaag
aaaaataagctgtgccagaacaggagtaattcattgcagaacaccaatgtcccacattca
gcatttatttctccaaagataatcagtgggaaagaagttgaggaagtaagttgtgtagaa
acacaggacaatcatacctcagaaggagaggcaagaacttgccatgaagcgtctgtcaga
caggattcttcagtttcagacaaacagcggcaaaccatcatcattgccgactccccaagt
cctgccgtgagtgtgatcaccattagcagtgacactgatgacgaagagacctcacccaga
ccttcactccgagagtgtaaaggtagtctggattgtgaagcttgccaaagcactttgaat
attgatcggatgtgttcactcagcagtcccgacagcactctgagtaccagctcctcaggg
cagtccagcccatccccttgcaaaagaccgaacagtatgtcagatgatgaacaggaaagt
gggtgtgagactgtggacggctctccaacgtcagactcctcggggcatgacagtccattt
gcagagagcagttttgtggaagacactcctcaaaacccagagctggggacttgtgctggc
acagaggccaagccagctcttagcactgctgtggagccaccagtggggacagagcgtggc
ctgaacgtcgatgcgcacatggccaacacagattctacatgccagccattgacaaaaggc
cagcccgcccctggaaagctgaaccagccctctgcctcggctgctcgtcagcaaaagccc
acatcagcattccagcagcagcatttgaacctgagccaggttcagcatttcggaactggg
catcaagaatggaatggaaactttgggcatcgaagacagcaagcatatattcctactagt
gttaccagtaatccattcactctttctcacggaagtcccaaccacacagcagtgcatgcc
catctggctggaagtgcgcacctcggaggacagcccactctgcttccgtacccgccatca
actgccctcagtagtgctgcacccgtggcccacctcctagcctctccgtgtacctcaaga
cctatgttacagcatccaacttataatatctcccatcccagtggcatagttcaccaagtc
cccgtgggcataaatccccgcctgttaccatccccgaccattcatcagactcagtacaaa
ccaatcttccctccacattcttacattgcagcatcgcctgcatatactggatttccattg
agtccaacaaaactcagccagtatccatatatgtga

DBGET integrated database retrieval system