KEGG   Rattus norvegicus (rat): 308451
Entry
308451            CDS       T01003                                 

Gene name
Itpkc
Definition
(RefSeq) inositol-trisphosphate 3-kinase C
  KO
K00911  1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04070  Phosphatidylinositol signaling system
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    308451 (Itpkc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    308451 (Itpkc)
   04070 Phosphatidylinositol signaling system
    308451 (Itpkc)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     308451 (Itpkc)
SSDB
Motif
Pfam: IPK
Other DBs
NCBI-GeneID: 308451
NCBI-ProteinID: NP_835195
RGD: 631336
Ensembl: ENSRNOG00000013945
UniProt: Q80ZG2
Position
1
AA seq 678 aa
MRRCPCRGSLSEAEAGALPAEARMGLEALRGGRRRQPGLQRPGPGAGGPTGRPEGGGPRA
WIEGFSLHSEAERTDFGPAPCPDGPQAEPCGDEHEECEAAGLGVASEKPSQNKELDGSNL
QTHPKLSSPLAEMEMAGSWTDGFRTDLHRPDLQARPKRASLCTQPGFDESWTELDRSELW
QTLPERDKPWVDHLRTHQDMSRLQNHPACPSPEPSAGTSCKELSADGSRTPHDTDGFWIE
SQTDGSLIGPSTQTACRQPANDGFSAQDTDGTLIQPGTDDGPWVDSVLEKSNGDDPLMEP
EPRDLVTNLCSHLECSSLCPVPRLIITSESPEPGAQPLGPQARIEGGTGGFSSASSFDES
EDDLVAGGGGTSDPEDRSGSKPWKKLKTVLKYSPFVVSFHKHYYPWVQLSGHAGNFQAGE
DGRILKRFCQCEQRSLELLMGDPLRPFVPTYYGMVQRDGQAFNQMEDLLADFEGPSIMDC
KMGSRTYLEEELVKARERPKPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQWRETLS
STSTLGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVNGDVGILRKYVARLEDLRDT
LENSPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQMLSHRLPWAEGNREDG
YLWGLDNLICLLQGLAQS
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgaggcgctgcccgtgccgggggagcctgagcgaggcggaggccggcgcattgccagcc
gaggcccgcatggggctggaggcgctgcgaggtgggcggcggcgacagccgggattgcag
cgccctgggccgggagcaggtggcccgacgggacggccagaggggggcggtccccgggcc
tggatcgaggggttcagcctgcactcagaggcggagaggaccgacttcgggcctgcgccg
tgtccggacggtccacaggcagaaccctgtggagacgaacacgaggagtgcgaagcagct
ggcctaggagttgcctcggagaagcccagccaaaataaggagctagacgggtccaacctc
cagacacatccaaaactgagcagccccctggctgagatggagatggccggttcctggaca
gatggttttcgaactgatcttcacagacctgacctccaggctcggccaaagagagccagc
ctctgtacccaaccagggtttgatgaatcctggaccgaactggacagatccgagctgtgg
cagactctaccagagagggacaagccctgggttgatcacctccggacccaccaagacatg
tccagactccaaaatcacccagcctgcccctcaccagagccaagtgctggtacctcctgc
aaagaattgagcgcagatggttccaggacaccacatgacaccgatggcttctggatagag
tcccaaactgatggctccctcataggacctagtactcagacagcctgcagacagcctgca
aacgatggtttttcagcacaggacactgacggtactttgattcaacctggcactgatgat
ggtccctgggttgatagcgttttggagaagtccaatggagatgatccattaatggaacca
gagcccagagacttggtgactaacctgtgctcccacctggagtgcagctccctgtgtcct
gtgccccgccttatcatcacctcagagtctcctgagcctggggcccagccgctgggaccc
caagcccggattgagggggggactggcggcttctcttctgcctcctcttttgacgaatct
gaggatgacttggtggctgggggcggaggtaccagcgatcctgaggacagatctggaagc
aagccctggaagaagctgaagacagttctgaagtactcgcctttcgtggtctccttccat
aagcactactacccctgggtacagctttccggacatgctgggaacttccaggctggtgag
gatggccggattctgaaacgtttctgccaatgtgagcagcgcagcctggagctgctgatg
ggagaccccctgcggcctttcgtgcccacttattatggcatggtgcagcgggatggccag
gccttcaaccagatggaagacctcctggccgactttgagggcccctctatcatggactgc
aagatgggcagcaggacatacctggaagaggagctggtgaaggcccgggaacgacccaaa
ccccggaaagatatgtatgagaagatggtggcagtggacccaggggctcccaccccagag
gagcacgctcagggtgcggtcactaagccccgatacatgcagtggagggagaccctgagt
tcaacttccaccctgggcttccggattgaaggcatcaagaaggccgatgggacctgcaac
accaacttcaagaagacacaggctctggagcaggtgacaaaggtgttggaagactttgtg
aatggggacgttggaatcctaagaaagtacgtggcgcgactggaggaccttcgagacact
ctggagaattctcccttcttcaagacccacgaggtagtgggcagttccctgctctttgtg
catgaccacaccggcctggccaaggtttggatgattgacttcggcaagacagtggccctg
cctgaccaccagatgctcagtcacaggctgccttgggctgagggcaaccgtgaagatggc
tacctctggggtttggacaatttgatctgcctccttcagggcctggcccagagctga

KEGG   Rattus norvegicus (rat): 54260
Entry
54260             CDS       T01003                                 

Gene name
Itpkb
Definition
(RefSeq) inositol-trisphosphate 3-kinase B
  KO
K00911  1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04070  Phosphatidylinositol signaling system
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    54260 (Itpkb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    54260 (Itpkb)
   04070 Phosphatidylinositol signaling system
    54260 (Itpkb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     54260 (Itpkb)
SSDB
Motif
Pfam: IPK
Other DBs
NCBI-GeneID: 54260
NCBI-ProteinID: NP_062185
RGD: 2932
Ensembl: ENSRNOG00000002969
UniProt: P42335
Position
13
AA seq 934 aa
MAVYCYALNSLVIMNSTNELKSGSPLPSGSETPQPSGRAALSPGSVFSPGRGASFLFPPA
ESLSLEEPGSAGGWRSGRRRLNSSSGSGGGSSSSNSSSSSGVGSPSWAGRLRGDAQQVVA
TRILSPPGPEEAQRKLRILQRELQNVQVNQKVGMFEAQIQAQTSAIQAPRSPRLGRARSP
SPCPFRSSSQPPERVLAPCSPSEERRTKSWGEQCTETPDANSRRRSRLSTHPSKDKEGVA
PLLGPASPTRLGTQSPSTSVRMERGSPASPRCGSPTPMEIDKRTAPSLEHFGTSLTLATK
VAASAASAGPHPGHDSVLMEADCELGAMRPWEAHLERRGQFLGRETGSAPEPIRTHIREP
PGRVERVHSVGGQGSWTPEVIKRPEEGTVDAQSSELSENPRWSRLPGDPGSVGPEKGGSR
IPGIRGPQQTLDSMREGSSALGLLGGSQAAQPGSMDVETGISCGRMLEPLPPGEVTTNLK
EPQCLPGDRMGMQPESSIVWPSAVEEAPLIWTCDTGIQLKGTWRSQDGDAHPSCQEKSPD
QKDKACSPSNIPAIPAVIITDMGAQEDGGLEEIQGSPRGPLPLRKLSSSSASSTGFSSSY
EDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVQWSPFVMSFKKKYPWIQ
LAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDL
LADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVT
KPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKTKTREQVTEAFREFTKGNQNILI
AYRDRLKAIRETLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQH
DVPWQEGNREDGYLSGLNNLIDILTEMSQGSPLT
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggctgtgtactgctatgccctcaatagcctggtgatcatgaacagcaccaacgagctg
aagagtggcagccccctgcccagcggcagcgaaacgcctcagccctccgggagggccgcg
ctgagccccggcagcgtcttcagccctgggagaggcgcctcctttctcttccccccagca
gagtcgctgtcgctggaggagcctgggagtgctgggggttggcgcagcggccgacggagg
ctgaatagtagcagcggtagcggaggtggcagcagcagcagcaacagcagcagcagcagt
ggcgtgggcagtcccagttgggctggccgcctgcgaggggacgcgcagcaggtggtggcg
acccgcatcctctccccacctgggccggaggaggcccagaggaagctgaggattctgcag
cgcgaattgcaaaatgtgcaggtgaaccagaaagtgggcatgttcgaggcgcaaatccag
gcacagacctctgctattcaagcgccccgaagcccgcgtttgggtagggctcgttcgccc
tccccgtgtcccttccgaagcagcagccagcctcctgaaagggtcttggctccatgttcc
ccaagtgaggaacggagaacaaagtcctggggagaacaatgtacagagaccccagatgcc
aactccaggaggagaagcagactcagcacacacccctcgaaggacaaggagggagtggcc
cctcttttaggcccagccagcccgaccaggttagggactcagagtccatctacttcagtg
agaatggaaagaggttccccggccagtccccgctgtggctcacccacacccatggaaatt
gacaagaggactgctccctcactggagcactttgggactagcttaacgttggccactaaa
gtggcagcttcggccgcatccgctggaccacaccctggacatgattctgttctcatggag
gcagactgtgagctaggggccatgcgcccctgggaggcccacctggagagacgggggcag
tttctgggcagggagaccggctcagccccagagcctatccggacccacattagagaaccc
cctggaagggtggaaagagttcattctgttggtggccagggctcctggacacctgaagtc
atcaaaagaccagaagagggaactgtggatgcccaaagctcagagctctcagagaacccg
agatggtctagactgcctggagacccgggttccgtagggcctgagaagggaggtagtagg
atcccaggaatccgaggaccccagcagaccctggacagcatgagagaagggtcttcagca
ctgggcttgcttgggggcagccaggcagcacagccagggagcatggatgtggagacaggc
attagttgtggcagaatgctggaacccttaccacctggggaagtaacaacaaatttgaaa
gaaccccagtgcctccctggggacaggatggggatgcagcctgagagttccatagtttgg
cccagtgctgtggaggaagctcccctgatctggacgtgtgacacagggatacagttaaag
gggacttggagaagccaagatggagatgctcatcctagctgccaagagaagtccccagac
cagaaggacaaggcctgcagccccagcaacatcccggccatccctgcagtcatcattaca
gatatgggtgctcaggaggatggagggttagaggagatccaaggaagccctcggggtccc
ctgcctctgaggaagctgtcgtcctcctcagcctcctccactggcttctcctcttcctat
gaggactcggaggaggacatctccagtgaccctgagcgcactctggaccccaactcagcc
tttttgcataccttggaccagcagaagcccagagtgagcaagtcatggaggaagataaag
aacatggtgcagtggtccccctttgtcatgtccttcaagaagaagtacccctggatccag
ctggcaggacatgcagggagcttcaaggcagctgcgaatggccgtatccttaagaagcat
tgtgagtctgaacagcgatgcctggaccggttaatggcggatgtgctgaggcccttcgtg
ccagcctaccatggcgacgtggtgaaggacggggaacgctacaaccagatggacgacctg
ctggctgacttcgattcaccctgcgtgatggactgcaagatgggcatcaggacatacctg
gaggaagaactcaccaaggcccggaagaagcctagcttgcggaaggacatgtaccagaag
atggtggaggtggaccctgaggcccccactgaagaggagaaagcccagagagctgtgacc
aagccacgttatatgcagtggcgggaaaccatcagttccacagctaccttaggcttcagg
atcgagggcatcaagaaggaagatggctctgtgaaccgtgacttcaagaagaccaaaaca
agggagcaggtcactgaggccttcagagaattcactaaaggaaaccagaacatcctgatt
gcctaccgggaccggttgaaggccattcgagaaaccctggaagtctctcccttcttcaag
tgccatgaggtcattggcagctctctcctcttcatccacgacaagaaggagcaagccaag
gtgtggatgattgactttgggaaaaccacgccccttccggaaggccagaccctacaacac
gatgtcccctggcaggaggggaaccgggaggatggctacctctcagggctgaacaacctc
atcgacatcctgacagaaatgtcccagggcagcccactcacctga

KEGG   Rattus norvegicus (rat): 81677
Entry
81677             CDS       T01003                                 

Gene name
Itpka
Definition
(RefSeq) inositol-trisphosphate 3-kinase A
  KO
K00911  1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04070  Phosphatidylinositol signaling system
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    81677 (Itpka)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    81677 (Itpka)
   04070 Phosphatidylinositol signaling system
    81677 (Itpka)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     81677 (Itpka)
SSDB
Motif
Pfam: IPK
Other DBs
NCBI-GeneID: 81677
NCBI-ProteinID: NP_112307
RGD: 619950
Ensembl: ENSRNOG00000005284
UniProt: P17105
Structure
PDB: 
1TZD

Position
3
AA seq 459 aa
MTLPGHPTGMARPRGAGPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAK
RRGGQVPNGLPRAAPAPVIPQLTVTSEEDVAPASPGPPDREGNWLPAAGSHLQQPRRLST
SSLSSTGSSSLLEDSEDDLLSDSESRSRGNVQLETSEDVGQKSHWQKIRTMVNLPVMSPF
KKRYSWVQLAGHTGSFKAAGTSGLILKRSSEPEHYCLVRLMADVLRGCVPAFHGVVERDG
ESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTE
EEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVTRVFEEF
MQGDAEVLKRYLNRLQQIRDTLEISDFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKTTP
LPDGQILDHRRPWEEGNREDGYLLGLDNLIGILANLAER
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaccctgcccggacacccgacgggcatggcgcgaccacggggcgcggggccctgcagc
cccgggttggagcgggctccgcgccggagcgtcggggagctgcgcctgctcttcgaagcg
cgctgcgccgcagtcgccgccgcagcggccgcaggggagccccgggcccgcggggccaag
cggcgtgggggacaagtgcctaacgggctcccgcgtgctgcccctgctccggtgatcccg
cagctcactgtgacaagcgaggaggatgtggccccggccagccccgggccgccggaccgg
gaggggaactggctcccagctgcggggtcgcacctgcagcagccacgccgcctctccacc
tcgtccctctcctccaccggctcctcgtcgctgctcgaggactcggaggacgacctgctg
agcgacagcgagagccggagccgcggcaacgtgcagctggaaaccagcgaagacgtgggg
cagaaaagccattggcagaagatccgtaccatggtcaacctgcctgtcatgagtcctttc
aaaaagcgctactcctgggtgcagttagcagggcacacagggagtttcaaagctgcgggc
accagcggcctgatcctgaagcgcagctcggagcctgaacactactgcctggtgcggttg
atggctgatgtgctgcgtgggtgtgtgccggccttccacggtgtggtcgagcgggatggt
gaaagctacttacagttacaggacctgcttgatggcttcgatggaccttgcgtgcttgac
tgcaagatgggtgtcagaacttacctggaagaagagctgaccaaagcccgagaacggccc
aagctgcgaaaggacatgtataagaaaatgctggccgtggaccccgaggcacctactgag
gaggagcatgcgcagcgtgccgtcacaaaacctcgatacatgcaatggcgcgaaggcatc
agctccagcactacactcggcttccgcatcgagggcatcaagaaagccgatggatcttgc
agtactgatttcaaaactacacgaagcagagagcaagtgactcgagtctttgaggagttc
atgcaaggagatgctgaagtgctgaagaggtatctgaaccgcctacagcagatccgggat
accctggagatctctgatttctttagacggcacgaggtgattggcagctcactcctcttc
gtgcatgaccattgccatcgcgctggtgtgtggctcatcgattttggcaagaccacgcct
ctccccgatggccagatcctggatcatcggaggccctgggaggagggcaatcgtgaggac
ggctatttgctggggctggacaatctcattggcatcttggccaacctggctgagagatga

DBGET integrated database retrieval system