KEGG   Rattus norvegicus (rat): 308457
Entry
308457            CDS       T01003                                 

Gene name
Egln2, HIF-PH1, HPH-1, HPH-3, PHD-1, PHD1
Definition
(RefSeq) egl-9 family hypoxia-inducible factor 2
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    308457 (Egln2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    308457 (Egln2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    308457 (Egln2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     308457 (Egln2)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Other DBs
NCBI-GeneID: 308457
NCBI-ProteinID: NP_001004083
RGD: 631376
Ensembl: ENSRNOG00000020947
UniProt: Q6AYU4
Position
1q21
AA seq 415 aa
MDSPCQPQALNQALPQLPGSVSESLEPSRARMGVESYLPCPLLPSYHRSGASGEASAGNG
TPRTTATATTTTASPLREGFGGQDGGELWPLQSEGAAALVTKECQRLAAQGARPEAPKRK
WAKDGGDAPSPSKRPWARQENQEAKGESGVGCDSGGGSSNSTTHSSGEASSRLREEAQPS
APERLALDYIVPCMRYYGICVKDNFLGAVLGGRVLAEVEALKWGGRLRDGQLVSQRAIPP
RSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGNYVINGRTKAMVACYPGNGL
GYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWS
DRRNPHEVKPAYATRYAITVWYFDAKERAAARDKYQLASGQKGVQVPVSQPATPT
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggacagcccgtgccagccgcaggccctgaatcaagctctccctcagttgccagggtct
gtgtcagagtccttggagcctagccgagccaggatgggggtggagagttacctgccctgt
cctctgctcccctcctaccaccgttcaggagcatctggggaggcctcggctggcaacggg
acccccagaaccacagccactgctactactaccactgccagtcccctgcgggagggcttt
ggtgggcaggatggtggtgagctgtggccactgcagagtgaaggtgctgctgcgttggtt
accaaggagtgccagcgactggcggcccagggtgcccgacctgaggcccccaaacggaag
tgggccaaggatggtggggatgccccttcacccagcaagcgaccgtgggccaggcaagag
aaccaggaggccaagggggaaagtggtgtgggctgtgacagcggtggcggcagcagcaac
agcactacccatagcagtggcgaggcaagttctaggctgagggaggaagcccagccctct
gcacctgagcgcctggccttggactatattgtgccttgcatgcggtactatggtatctgc
gtcaaggacaacttcttgggggcagtactgggtggccgtgtgctggctgaggtggaagcc
ctgaagtggggcgggcgtctacgtgatgggcaactagtgagccagcgggcgatcccaccg
cgcagcattcgtggggaccagattgcctgggtagaaggccacgagccaggctgccggagc
attggtgccctcatggctcatgtggacgcagtaatccgccactgtgcagggcggctgggc
aactacgtcatcaatgggcgcaccaaggccatggtggcgtgttacccaggcaatgggctc
gggtacgtgaggcatgttgacaatccccacggcgatgggcgctgcatcacctgtatctat
tacctgaatcagaactgggatgttaaggtgcatggcggcctgctgcagatcttccctgag
ggtcggccagtggtagccaacatcgagccactctttgaccggttgctcattttctggtct
gaccgacggaatccacatgaggtgaagccagcctatgccaccaggtacgccatcactgtc
tggtattttgatgccaaggagcgggcagcagccagagacaagtatcagctagcatcggga
cagaaaggtgttcaagtacccgtgtcacagccagctacacctacctaa

DBGET integrated database retrieval system